Microcystis panniformis: VL20_1699 Help Entry VL20_1699         CDS       T04037                                  Name (GenBank) Ferredoxin   KO K17892   ferredoxin-thioredoxin reductase catalytic chain [EC:1.8.7.2] Organism mpk  Microcystis panniformis Brite KEGG Orthology (KO) [BR:mpk00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     VL20_1699 Enzymes [BR:mpk01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.7  With an iron-sulfur protein as acceptor     1.8.7.2  ferredoxin:thioredoxin reductase      VL20_1699 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FeThRed_B Motif Other DBs NCBI-ProteinID:  AKV66851 UniProt:  A0A0K1RYR9 LinkDB All DBs Position 1431250..1431570 Genome browser AA seq 106 aa AA seqDB search MKNFAEQYARRTNTYFCSDLSVTAVVIEGLARHKDELGSPLCPCRHYEDKEAEVKNTFWN CPCVPMRERKECHCMLFITPDNEFAGEEQTISLDYIQEVRESMKGH NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgaagaattttgccgaacagtacgctagacgtacaaatacttacttctgtagcgatctc tcggtgacagcggtggtaattgaggggttagcgcgtcataaggacgaattaggctctcct ttatgtccctgtcgtcactacgaagacaaagaagcggaggtaaaaaatactttctggaat tgtccctgtgtgccgatgcgggaacggaaagaatgtcactgtatgctatttattaccccc gataacgagtttgctggggaagaacagacaatttccctcgactatatccaagaagtccgc gaatcgatgaaggggcattag

DBGET integrated database retrieval system