Methanosphaerula palustris: Mpal_0599 Help Entry Mpal_0599         CDS       T00823                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mpl  Methanosphaerula palustris Pathway mpl03010   Ribosome Brite KEGG Orthology (KO) [BR:mpl00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mpal_0599   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mpal_0599  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mpl03011]     Mpal_0599    04121 Ubiquitin system [BR:mpl04121]     Mpal_0599   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpl04147]     Mpal_0599 Ribosome [BR:mpl03011]  Ribosomal proteins   Eukaryotes    Small subunit     Mpal_0599   Archaea     Mpal_0599 Ubiquitin system [BR:mpl04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mpal_0599 Exosome [BR:mpl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Mpal_0599   Exosomal proteins of colorectal cancer cells    Mpal_0599 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_NUD Zn_ribbon_Nudix Zn_Ribbon_1 Rcat_RNF216 IBR Auto_anti-p27 Zn_ribbon_RPB9 MqsA_antitoxin Lar_restr_allev Ribosomal_L37e GFA DUF1451 DZR Zn_ribbon_IS1595 DUF5817 PknG_rubred Zn_ribbon_NOB1 DZR_2 DUF1936 zf_UBZ Motif Other DBs NCBI-ProteinID:  ACL15970 UniProt:  B8GFC2 LinkDB All DBs Position complement(591671..591826) Genome browser AA seq 51 aa AA seqDB search MADKRSAYFKVEGSGVTLNKRYCPRCGAGVIMAEHKDRSACGKCGYTEFRK NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggcagacaagcgaagtgcatacttcaaggtcgaaggatcaggtgtgacactgaacaag cgctactgtccccggtgtggggctggcgtgatcatggcagagcacaaggaccgcagcgca tgcggcaagtgcggctatactgaatttagaaaatag

DBGET integrated database retrieval system