Methanosphaerula palustris: Mpal_2504 Help Entry Mpal_2504         CDS       T00823                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism mpl  Methanosphaerula palustris Pathway mpl00362   Benzoate degradation mpl01100   Metabolic pathways mpl01120   Microbial metabolism in diverse environments mpl01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:mpl00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     Mpal_2504    00622 Xylene degradation     Mpal_2504    00621 Dioxin degradation     Mpal_2504 Enzymes [BR:mpl01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      Mpal_2504 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_3 Tautomerase_2 MIF Motif Other DBs NCBI-ProteinID:  ACL17777 UniProt:  B8GES6 LinkDB All DBs Position 2641080..2641295 Genome browser AA seq 71 aa AA seqDB search MPFVKIEHVAGEFSAEQRADLGREITDLVAKAAGVPPTLVWIVFHEIPAENWMIGRKTIP ELMGETGATKK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgccttttgttaagatcgagcatgtggcgggtgagttctctgcggaacagcgtgctgac ctcggccgcgagatcactgacctggtcgccaaagcggcgggggtaccaccaacactggtc tggatcgtgttccacgaaatcccggcagagaactggatgatcggccggaagaccatcccc gaactcatgggagaaacgggagcgacgaagaagtag

DBGET integrated database retrieval system