Methylorubrum populi: Mpop_0529 Help Entry Mpop_0529         CDS       T00760                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mpo  Methylorubrum populi Pathway mpo01100   Metabolic pathways mpo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mpop_0529    00074 Mycolic acid biosynthesis     Mpop_0529   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mpop_0529 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF1493 TerB DUF5783 DNA_Packaging_2 Motif Other DBs NCBI-ProteinID:  ACB78707 UniProt:  B1ZK55 LinkDB All DBs Position 567043..567279 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVVEHLGVEPEKVTEASNFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIQTVGDAIKFLEKNSA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgccgagcgcgtgaagaagatcgtcgtcgagcacctgggcgtcgagcct gagaaggtcaccgaggcctccaacttcatcgacgatctcggcgccgacagcctcgacacc gtcgagctggtgatggcgttcgaggaggagttcaacgtcgagatcccggacgacgcggcc gagaccatccagacggtcggcgacgcgatcaagttcctggagaagaactccgcctaa

DBGET integrated database retrieval system