Methylocapsa polymorpha: RZS28_08780 Help Entry RZS28_08780       CDS       T11074                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mpol  Methylocapsa polymorpha Pathway mpol00190   Oxidative phosphorylation mpol01100   Metabolic pathways Module mpol_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mpol00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RZS28_08780  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mpol00194]     RZS28_08780 Photosynthesis proteins [BR:mpol00194]  Photosystem and electron transport system   F-type ATPase [OT]    RZS28_08780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WOJ91331 LinkDB All DBs Position complement(1919071..1919313) Genome browser AA seq 80 aa AA seqDB search MDLKVISIIGAALAVSIGSIGPALAEGRAVAAAMDAIARQPEAAGTISRTLFVGLAMIET MAIYCLVVALLLLFANPYAG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggacttgaaagtcatcagcatcatcggcgcagcgctcgccgtctcgatcggctcgatc gggccggcgctggccgaaggccgagcggtcgccgccgcaatggacgcgatcgcgcgccag cccgaggctgccgggacgatctcgcgcaccctcttcgtcggtctcgccatgatcgagacg atggcgatctactgcctggtcgtggcgctcctgctgcttttcgccaatccctacgccggc tga

DBGET integrated database retrieval system