Micrococcus porci: KW076_09655 Help Entry KW076_09655       CDS       T09146                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mpor  Micrococcus porci Pathway mpor00998   Biosynthesis of various antibiotics mpor01100   Metabolic pathways mpor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KW076_09655    00074 Mycolic acid biosynthesis     KW076_09655   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KW076_09655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UBH24137 LinkDB All DBs Position 2043799..2044044 Genome browser AA seq 81 aa AA seqDB search MASKEEILAGLAEIVNEETGLETADVQPEKSFTDDLDIDSISMMTIVVNAEDKFGVKIPD EEVKNLKTVQDAVDFIDQAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcttccaaggaagagatcctcgccggcctggccgagatcgtgaacgaggagaccggc ctcgagaccgccgacgtccagccggagaagtccttcaccgacgacctcgacatcgactcg atctccatgatgacgatcgtcgtgaacgccgaggacaagttcggtgtgaagatcccggac gaggaggtcaagaacctcaagaccgtccaggacgccgtcgacttcatcgaccaggcccag gcctga

DBGET integrated database retrieval system