Methanohalophilus portucalensis: BKM01_03135 Help Entry BKM01_03135       CDS       T09768                                  Name (GenBank) ribonuclease P   KO K03538   ribonuclease P protein subunit POP4 [EC:3.1.26.5] Organism mpot  Methanohalophilus portucalensis Pathway mpot03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:mpot00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     BKM01_03135  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:mpot03009]     BKM01_03135    03016 Transfer RNA biogenesis [BR:mpot03016]     BKM01_03135    03029 Mitochondrial biogenesis [BR:mpot03029]     BKM01_03135 Enzymes [BR:mpot01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      BKM01_03135 Ribosome biogenesis [BR:mpot03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      BKM01_03135 Transfer RNA biogenesis [BR:mpot03016]  Eukaryotic type   5'processing factors    Ribonucrease P     BKM01_03135 Mitochondrial biogenesis [BR:mpot03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     BKM01_03135 SSDB OrthologParalogGFIT Motif Pfam:  RNase_P-MRP_p29 DUF2498 Motif Other DBs NCBI-ProteinID:  ATU09223 UniProt:  A0A2D3C929 LinkDB All DBs Position 588398..588658 Genome browser AA seq 86 aa AA seqDB search MVEVVDSTNKYLAGINGKVVDETRNMLVIEVEDMYEKQVPKKGSTFVFHLPVGSGCSPAT SVEVGGTLLLSQPENRTKNIRKLRMR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggttgaggtggttgattctaccaataaatatcttgcaggcattaatggaaaagtagtt gatgagacacggaacatgttggtaatcgaggtcgaggatatgtacgaaaaacaagtacca aaaaaaggttccacatttgtgtttcatcttccagttggttctggatgttccccggctaca tcagtagaggtcgggggcaccctcttgctctcacaacccgaaaacaggaccaagaatatc aggaaattacgcatgaggtaa

DBGET integrated database retrieval system