Methanohalophilus portucalensis: BKM01_10065 Help Entry BKM01_10065       CDS       T09768                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mpot  Methanohalophilus portucalensis Pathway mpot03010   Ribosome Brite KEGG Orthology (KO) [BR:mpot00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     BKM01_10065   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     BKM01_10065  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mpot03011]     BKM01_10065    04121 Ubiquitin system [BR:mpot04121]     BKM01_10065 Ribosome [BR:mpot03011]  Ribosomal proteins   Eukaryotes    Large subunit     BKM01_10065   Archaea     BKM01_10065 Ubiquitin system [BR:mpot04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    BKM01_10065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 Zn_ribbon_3 Zn_ribbon_ZPR1 DZR zf-AtTam37 Cas12f1-like_TNB Zn_ribbon_RPAB4 DZR_2 HypA Motif Other DBs NCBI-ProteinID:  ATU09079 UniProt:  A0A2D3C8K1 LinkDB All DBs Position complement(1968911..1969060) Genome browser AA seq 49 aa AA seqDB search MARFPEAEERILNKKICMNCNARNAVRAVKCRKCGYKNLRVKSKEVKRG NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcaagattccccgaagctgaggaacgtatacttaataagaagatctgcatgaattgc aatgcccgtaacgctgtaagggctgttaaatgcagaaagtgtggttacaaaaatctccgt gtaaaatccaaggaagtaaagagaggctga

DBGET integrated database retrieval system