Micromonas pusilla: MICPUCDRAFT_12795 Help Entry MICPUCDRAFT_12795 CDS       T02696                                  Name (RefSeq) uncharacterized protein   KO K02183   calmodulin Organism mpp  Micromonas pusilla Pathway mpp04016   MAPK signaling pathway - plant mpp04070   Phosphatidylinositol signaling system mpp04075   Plant hormone signal transduction Brite KEGG Orthology (KO) [BR:mpp00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     MICPUCDRAFT_12795    04070 Phosphatidylinositol signaling system     MICPUCDRAFT_12795    04075 Plant hormone signal transduction     MICPUCDRAFT_12795  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mpp01009]     MICPUCDRAFT_12795   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpp04131]     MICPUCDRAFT_12795    03036 Chromosome and associated proteins [BR:mpp03036]     MICPUCDRAFT_12795   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpp04147]     MICPUCDRAFT_12795 Protein phosphatases and associated proteins [BR:mpp01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      MICPUCDRAFT_12795 Membrane trafficking [BR:mpp04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     MICPUCDRAFT_12795 Chromosome and associated proteins [BR:mpp03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      MICPUCDRAFT_12795 Exosome [BR:mpp04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    MICPUCDRAFT_12795 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  9681093 NCBI-ProteinID:  XP_003055665 JGI:  12795 UniProt:  C1MIH3 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search TEEILDGIMSRFDVDGAGYVDLPKFCNFLMSRSKGGPAELRKAFTHFDKDRSGFITKTQL AEALHDFQMALSPAELDALIARYDSTGTGQISKADFV NT seq 291 nt NT seq  +upstreamnt  +downstreamnt acggaggagattttggacgggatcatgtcgcggttcgacgtcgacggcgccgggtacgtc gacttgccgaaattttgcaatttcctcatgtctcgcagcaaaggcggccccgcggagctt cgcaaggcgttcacgcactttgacaaggaccggagcgggtttattacgaaaacgcagctc gctgaggcgttacacgacttccagatggccctctcccccgcggaactcgacgcgctcatc gcgcggtacgactccacggggacggggcaaatctccaaggcggatttcgtc

DBGET integrated database retrieval system