Micromonas pusilla: MICPUCDRAFT_13695 Help Entry MICPUCDRAFT_13695 CDS       T02696                                  Name (RefSeq) uncharacterized protein   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism mpp  Micromonas pusilla Pathway mpp03018   RNA degradation mpp03040   Spliceosome Brite KEGG Orthology (KO) [BR:mpp00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     MICPUCDRAFT_13695   09123 Folding, sorting and degradation    03018 RNA degradation     MICPUCDRAFT_13695  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mpp03019]     MICPUCDRAFT_13695    03041 Spliceosome [BR:mpp03041]     MICPUCDRAFT_13695 Messenger RNA biogenesis [BR:mpp03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      MICPUCDRAFT_13695   mRNA degradation factors    5'-3' decay     Lsm complex      MICPUCDRAFT_13695 Spliceosome [BR:mpp03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     MICPUCDRAFT_13695  Complex C   U2 snRNP components     MICPUCDRAFT_13695 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX Motif Other DBs NCBI-GeneID:  9682008 NCBI-ProteinID:  XP_003056127 JGI:  13695 UniProt:  C1ML79 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search LFYSYFKTLMGKQVTVELKNDLAITGLLRSVDQYLNIKLQETVVVDEARYPHMSSVRSCF IRGSVVRYVQLPPDAVDVDILHDATRRDARGA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt ctgttctattcatactttaaaaccctaatgggcaagcaggtgacggttgagctgaaaaac gaccttgcaatcactggactactgcgatcggttgaccagtatttaaacattaagttgcaa gaaactgtagttgtcgatgaagcgcgatatccgcacatgagctcagttcgcagttgtttt attcgtggttctgtcgtacgctacgtgcagctgcctccagacgcagttgatgtggacata ctgcacgatgcaacaagacgagatgcccgcggtgcttga

DBGET integrated database retrieval system