Marinobacter psychrophilus: ABA45_11575 Help Entry ABA45_11575       CDS       T03980                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mpq  Marinobacter psychrophilus Pathway mpq01100   Metabolic pathways mpq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ABA45_11575    00074 Mycolic acid biosynthesis     ABA45_11575   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ABA45_11575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  AKO54338 UniProt:  A0A0H4I994 LinkDB All DBs Position complement(2578345..2578578) Genome browser AA seq 77 aa AA seqDB search MSTVEERVKKIVCEQLGVKESEVQNSSSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKLASVQNAIDYIVSHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtacagttgaagagcgcgttaagaagattgtttgtgagcagttgggcgttaaagag tccgaagttcaaaactcatcttcttttgttgaagatctgggcgctgactcactggacacc gttgagctggttatggcgttggaagaggaattcgaaactgaaattcctgacgaagaagcc gaaaagctggccagcgttcagaatgccatcgactacatcgtatcgcacacctga

DBGET integrated database retrieval system