Marinobacter psychrophilus: ABA45_16340 Help Entry ABA45_16340       CDS       T03980                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism mpq  Marinobacter psychrophilus Brite KEGG Orthology (KO) [BR:mpq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpq03036]     ABA45_16340 Chromosome and associated proteins [BR:mpq03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     ABA45_16340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Taxilin TSC22 ZapB Filament Tropomyosin Lipase_chap YabA DUF2937 WHD_TTC3 GapR_DNA-bd Motif Other DBs NCBI-ProteinID:  AKO53803 UniProt:  A0A0H4I7T3 LinkDB All DBs Position 3596660..3596866 Genome browser AA seq 68 aa AA seqDB search MEQPEVQVLADKLDQLLERYGKLELENQALKTRQEDWIRERAQLVHKNDLAKTKLEAMIG RLRALEQH NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggaacagcccgaagtacaggtgttggcggacaagctggatcagcttcttgaacgttac ggcaagcttgagctggaaaaccaggcactaaaaacacgccaggaagactggattcgcgag cgagctcagctggttcacaagaacgacctcgcaaaaaccaaacttgaagccatgataggc cgcctgcgggcattggagcagcattaa

DBGET integrated database retrieval system