Moniliophthora perniciosa: MPER_02087 Help Entry MPER_02087        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K13993   HSP20 family protein Organism mpr  Moniliophthora perniciosa Pathway mpr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mpr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MPER_02087  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mpr03110]     MPER_02087 Chaperones and folding catalysts [BR:mpr03110]  Heat shock proteins   HSP20    MPER_02087 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HSP20 ArsA_HSP20 CS BON Motif Other DBs NCBI-ProteinID:  EEB98407 LinkDB All DBs AA seq 105 aa AA seqDB search MDLHENAEKNVVTATFELPGLKKEDVQIDVQDGRLTIAGESKISEEHEKDGYAIRERRFG KFSRTLRLPQGVKEEEIKASLDNGVLTVTFPKAGAEVAPKRITVS NT seq 319 nt NT seq  +upstreamnt  +downstreamnt gatggacttgcatgaaaatgccgagaagaatgtcgtaactgccacattcgagcttcctgg gctcaagaaagaagacgtccagattgacgtgcaagatggacgcttgaccattgctggaga gtcaaagatctcggaagagcacgagaaagatggctatgctatccgagaacgcagatttgg aaagttttctaggacattgagacttcctcaaggtgtcaaggaggaagaaatcaaagcatc gttggacaatggtgtgctcaccgtgaccttcccgaaggctggagcagaagttgcaccgaa gaggataacggtatcttaa

DBGET integrated database retrieval system