Moniliophthora perniciosa: MPER_05226 Help Entry MPER_05226        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K08341   GABA(A) receptor-associated protein Organism mpr  Moniliophthora perniciosa Pathway mpr04136   Autophagy - other mpr04138   Autophagy - yeast mpr04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:mpr00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     MPER_05226    04136 Autophagy - other     MPER_05226    04139 Mitophagy - yeast     MPER_05226  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpr04131]     MPER_05226    04121 Ubiquitin system [BR:mpr04121]     MPER_05226    03029 Mitochondrial biogenesis [BR:mpr03029]     MPER_05226 Membrane trafficking [BR:mpr04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     MPER_05226 Ubiquitin system [BR:mpr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    MPER_05226 Mitochondrial biogenesis [BR:mpr03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     MPER_05226 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-ProteinID:  EEB95753 LinkDB All DBs AA seq 87 aa AA seqDB search MRSKFKDEHPFEKRKAEAERIRQKYPDRIPVICEKADRTDIPTIDKKKYLVPSDLTVGQF VYVIRKRIKLAPEKAFYFVDSSPASGL NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaggtccaaattcaaggatgagcacccctttgagaagcgcaaggctgaggcggagcgt attcgacagaagtacccagatcgtattcctgtcatctgtgagaaggcggatagaacagat atccccactattgacaagaagaagtatttggtgccctctgatctcactgtgggccaattc gtctatgtcattcgcaaacggatcaagcttgcacccgagaaagcattctatttcgttgac agttctccggccagcggtctttga

DBGET integrated database retrieval system