Moniliophthora perniciosa: MPER_06754 Help Entry MPER_06754        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K11252   histone H2B Organism mpr  Moniliophthora perniciosa Brite KEGG Orthology (KO) [BR:mpr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpr03036]     MPER_06754   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpr04147]     MPER_06754 Chromosome and associated proteins [BR:mpr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     MPER_06754 Exosome [BR:mpr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MPER_06754 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-ProteinID:  EEB94434 LinkDB All DBs AA seq 76 aa AA seqDB search ILGGLFRASVRAPPCFHSTFWSPCPPLQTRHLLEKSTISSREIQHPVRLILPGELAKHAI SEGTKSVTKYSSAGAK NT seq 233 nt NT seq  +upstreamnt  +downstreamnt gcattttgggcggtttgttccgagcatcagtacgtgcacctccttgttttcattcaactt tttggtcaccttgcccgcctttacaaactcgccacctattggaaaaatccaccatctctt cacgagaaatccaacatcccgttcgtctcattcttcctggtgaactcgccaagcacgcta tctctgagggtaccaagtcggtgacaaagtactcatcggcgggagccaagtag

DBGET integrated database retrieval system