Moniliophthora perniciosa: MPER_09086 Help Entry MPER_09086        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism mpr  Moniliophthora perniciosa Pathway mpr03022   Basal transcription factors mpr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mpr00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     MPER_09086   09124 Replication and repair    03420 Nucleotide excision repair     MPER_09086  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mpr03021]     MPER_09086    03400 DNA repair and recombination proteins [BR:mpr03400]     MPER_09086 Transcription machinery [BR:mpr03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      MPER_09086 DNA repair and recombination proteins [BR:mpr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      MPER_09086 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-ProteinID:  EEB92411 LinkDB All DBs AA seq 64 aa AA seqDB search MRAVKGFRSDPAVKQILLIMNERQHFILEDLDDNHLVIKADEEYRVRRELEAEVRISFSS DTKS NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgagggcagtgaaaggttttcgcagtgatcctgctgtaaaacagattctgctcatcatg aatgaaaggcagcatttcatccttgaagacctcgatgataatcatctagtcatcaaagca gatgaggagtatcgtgttcgaagagaacttgaagcagaagtgcgtattagtttcagcagc gatacaaaaagctaa

DBGET integrated database retrieval system