Moniliophthora perniciosa: MPER_12723 Help Entry MPER_12723        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K04513   Ras homolog gene family, member A Organism mpr  Moniliophthora perniciosa Pathway mpr04011   MAPK signaling pathway - yeast mpr04081   Hormone signaling mpr04144   Endocytosis mpr04517   IgSF CAM signaling mpr04519   Cadherin signaling mpr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mpr00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     MPER_12723   09133 Signaling molecules and interaction    04081 Hormone signaling     MPER_12723    04517 IgSF CAM signaling     MPER_12723    04519 Cadherin signaling     MPER_12723  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     MPER_12723  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     MPER_12723  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpr04131]     MPER_12723   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpr04147]     MPER_12723    04031 GTP-binding proteins [BR:mpr04031]     MPER_12723 Membrane trafficking [BR:mpr04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     MPER_12723 Exosome [BR:mpr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MPER_12723   Exosomal proteins of other body fluids (saliva and urine)    MPER_12723   Exosomal proteins of colorectal cancer cells    MPER_12723   Exosomal proteins of bladder cancer cells    MPER_12723 GTP-binding proteins [BR:mpr04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     MPER_12723 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-ProteinID:  EEB89204 LinkDB All DBs AA seq 196 aa AA seqDB search MSEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGKHVELALWDT AGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVMHFCAGLPIILVGCKKD LRRDPRVIEELRKTSQRPVTPEEGMAVAQKIGAKHYLECSAKTGEGVREVFQYATRAALL SRPGKSGKKGSKCTVL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgtcagaaatcaggagaaagttggttatcgttggtgacggtgcttgcggaaagacctgt cttttgattgtcttctcgaaaggaactttccccgaggtttatgtcccaaccgtctttgag aactacgtcgccgacgtcgaggtcgatggaaagcacgttgaactcgcattatgggatacg gccggacaggaagactacgatcgtcttcgacccctctcgtatcctgactcccatgttatc ctcatctgtttcgccgtcgacagcccagactccttggacaacgtccaggagaagtggatt tccgaggtcatgcacttctgtgctggtctccctatcatcctcgttggttgcaaaaaggat ctcaggcgcgaccctagagtgattgaggagcttagaaagacaagtcagaggccagttaca ccggaggagggtatggctgtcgctcagaagattggtgccaagcactatctagagtgctcc gccaagacaggcgagggcgtccgagaagtcttccagtacgctacacgggcagcgctgttg agccgacctggcaagtcaggcaagaagggcagcaagtgcaccgtactctaa

DBGET integrated database retrieval system