Moniliophthora perniciosa: MPER_13524 Help Entry MPER_13524        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K04482   DNA repair protein RAD51 Organism mpr  Moniliophthora perniciosa Pathway mpr03440   Homologous recombination mpr03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:mpr00001]  09120 Genetic Information Processing   09124 Replication and repair    03440 Homologous recombination     MPER_13524    03460 Fanconi anemia pathway     MPER_13524  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpr04131]     MPER_13524    04121 Ubiquitin system [BR:mpr04121]     MPER_13524    03400 DNA repair and recombination proteins [BR:mpr03400]     MPER_13524 Membrane trafficking [BR:mpr04131]  Protein recycling   Rab GTPases and associated proteins    Other Rab GTPase associated proteins     MPER_13524 Ubiquitin system [BR:mpr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    BRCC complex     MPER_13524 DNA repair and recombination proteins [BR:mpr03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     BRCA complex      MPER_13524     RecA family proteins      MPER_13524    FA (Fanconi anemia) pathway     Other FA pathway factors      MPER_13524 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rad51 Motif Other DBs NCBI-ProteinID:  EEB88575 LinkDB All DBs AA seq 84 aa AA seqDB search FGVAVVVTNQVMSNPDASAGPYAGNEKKPIGGNIMAHASTTRLQLKKSRGNTRSCKIYDS PCLPEMETHFAILPSGIGDHEEEA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt ttcggtgttgccgtcgttgtgacgaatcaagtcatgtccaatcctgatgcctccgctggt ccttatgctggaaacgagaagaagcctattggaggaaatattatggctcacgcatccacg actcgactacagcttaagaaatcaagggggaacactcgttcttgcaagatatatgattca ccatgtctaccagagatggagacacattttgctatcttaccaagtggtattggggatcat gaggaagaggcttga

DBGET integrated database retrieval system