Moniliophthora perniciosa: MPER_14772 Help Entry MPER_14772        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K01624   fructose-bisphosphate aldolase, class II [EC:4.1.2.13] Organism mpr  Moniliophthora perniciosa Pathway mpr00010   Glycolysis / Gluconeogenesis mpr00030   Pentose phosphate pathway mpr00051   Fructose and mannose metabolism mpr00680   Methane metabolism mpr00710   Carbon fixation by Calvin cycle mpr01100   Metabolic pathways mpr01110   Biosynthesis of secondary metabolites mpr01200   Carbon metabolism mpr01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:mpr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     MPER_14772    00030 Pentose phosphate pathway     MPER_14772    00051 Fructose and mannose metabolism     MPER_14772   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     MPER_14772    00680 Methane metabolism     MPER_14772 Enzymes [BR:mpr01000]  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.13  fructose-bisphosphate aldolase      MPER_14772 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  F_bP_aldolase Motif Other DBs NCBI-ProteinID:  EEB87752 LinkDB All DBs AA seq 69 aa AA seqDB search DIKAPIILQVSQGGSAYFAGKGLANDKQQASIAGAIAAAHHIRTVAKHYGVPVILHSDHC AQKLLPWFD NT seq 209 nt NT seq  +upstreamnt  +downstreamnt agacatcaaggctccgatcatcctccaagtctcccagggtggttctgcctactttgctgg caagggtctcgccaacgacaagcaacaagcttctatcgctggtgccattgccgccgctca ccatattcgaactgtcgccaagcactatggcgtccctgtcatcctccactctgaccactg cgcgcaaaaacttctcccttggttcgatg

DBGET integrated database retrieval system