Moniliophthora perniciosa: MPER_15744 Help Entry MPER_15744        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K05863   solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31 Organism mpr  Moniliophthora perniciosa Brite KEGG Orthology (KO) [BR:mpr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mpr03029]     MPER_15744   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mpr02000]     MPER_15744 Mitochondrial biogenesis [BR:mpr03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    Other mitochondrial DNA transcription and translation factors     MPER_15744 Transporters [BR:mpr02000]  Solute carrier family (SLC)   SLC25: Mitochondrial carrier    MPER_15744 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Mito_carr YhdP Motif Other DBs NCBI-ProteinID:  EEB87070 LinkDB All DBs AA seq 85 aa AA seqDB search NQDEMIKQGRLSAPYKGVSDAFARTIRDEGVASLWRGNVANVIRYFPTQALNFAFKDYFK TIFGSKRSDGYTRWMVGNIASGAAA NT seq 256 nt NT seq  +upstreamnt  +downstreamnt aatcaagatgagatgatcaaacaaggtcgactttcagccccctacaaaggcgtcagcgac gcatttgcaaggaccattcgtgacgagggggtggcatctttatggcgagggaacgtcgcc aatgtcattcgctactttccaacccaagccctgaactttgctttcaaggactatttcaaa actatttttggctcgaagcgatccgatgggtacactcgctggatggtaggcaacattgcc tccggcgctgcggcgg

DBGET integrated database retrieval system