Moniliophthora perniciosa: MPER_16282 Help Entry MPER_16282        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K10426   dynactin 4 Organism mpr  Moniliophthora perniciosa Pathway mpr04814   Motor proteins Brite KEGG Orthology (KO) [BR:mpr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     MPER_16282  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpr03036]     MPER_16282   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpr04812]     MPER_16282 Chromosome and associated proteins [BR:mpr03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      MPER_16282 Cytoskeleton proteins [BR:mpr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      MPER_16282 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-ProteinID:  EEB86678 LinkDB All DBs AA seq 59 aa AA seqDB search FNMLVSYTYRSDDPAPSDGNIMESPTKGGSKAEMKTFAFYTVVDLGAIVPREEPRLDDL NT seq 180 nt NT seq  +upstreamnt  +downstreamnt ttcaatatgttggtctcttacacttatcgctcggatgaccctgcgccgtccgacggcaat attatggaatctccgacaaaggggggctcgaaggcagagatgaagacatttgcgttctac acggttgtggatctgggcgccatcgtaccgagagaggaacccaggctagatgatctctag

DBGET integrated database retrieval system