Marinomonas profundi: J8N69_16600 Help Entry J8N69_16600       CDS       T07858                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mprf  Marinomonas profundi Pathway mprf00998   Biosynthesis of various antibiotics mprf01100   Metabolic pathways mprf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mprf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     J8N69_16600 (acpP)    00074 Mycolic acid biosynthesis     J8N69_16600 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     J8N69_16600 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF6137 AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  UDV03148 LinkDB All DBs Position complement(3561210..3561443) Genome browser AA seq 77 aa AA seqDB search MSSIEERVKKIVCEQLGVKEEDVVASASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAANDYINANL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtagcattgaagaacgcgttaaaaaaatcgtttgtgaacaactaggcgttaaagaa gaagatgttgttgcttcagcatcttttgttgatgacctaggtgccgattccctagatact gttgagctagtaatggctcttgaagaggaatttgatactgaaattcctgatgaagaagca gagaaaatcactactgtacaagcagcgaacgattacataaacgctaacttgtaa

DBGET integrated database retrieval system