Micromonospora profundi: Q3V37_12260 Help Entry Q3V37_12260       CDS       T09358                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mprn  Micromonospora profundi Pathway mprn00190   Oxidative phosphorylation mprn01100   Metabolic pathways Module mprn_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mprn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Q3V37_12260 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mprn00194]     Q3V37_12260 (atpE) Photosynthesis proteins [BR:mprn00194]  Photosystem and electron transport system   F-type ATPase [OT]    Q3V37_12260 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WLS48719 UniProt:  A0AAJ6L0W2 LinkDB All DBs Position 2649706..2649927 Genome browser AA seq 73 aa AA seqDB search MQVLAAIEGNVNTIGYGLAAIGPGIGVALVFAAYIQSSARQPESAGFNRTWLVLGFALVE ALALFGLVLAFAV NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcaggttcttgccgccatcgaaggcaacgtcaacaccatcggctatggcctcgccgcc atcggccccggtatcggtgtcgccctggtcttcgcggcctacatccagtcgagcgcccgc cagccggagtccgccggtttcaaccgcacctggctcgtcctgggcttcgccctggtcgag gcgctcgccctcttcggcctggttctcgccttcgccgtctga

DBGET integrated database retrieval system