Moorena producens: BJP34_07310 Help Entry BJP34_07310       CDS       T04499                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism mpro  Moorena producens Brite KEGG Orthology (KO) [BR:mpro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mpro03110]     BJP34_07310 Chaperones and folding catalysts [BR:mpro03110]  Protein folding catalysts   Protein disulfide isomerase    BJP34_07310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 SH3BGR GST_N_2 CLIC-like_N GST_N Thioredoxin_2 Glrx-like YfjL_C Motif Other DBs NCBI-ProteinID:  AOX04173 UniProt:  A0A1D8U2Y0 LinkDB All DBs Position 1915950..1916213 Genome browser AA seq 87 aa AA seqDB search MSANVEIYTWSSCPFCIRAKGLLNKKGVEFTEYSIDGDNQAREKMAQRANGARSLPQIFI NDQHIGGCDDLHTLEFQGQLDNLLKAS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcgcaaacgttgaaatctacacctggagcagttgccccttctgtatccgtgctaaa ggtctactaaacaagaagggagttgaatttactgaatactctattgatggtgataaccag gcacgggagaagatggctcaacgggcaaatggagcacgctccttaccacagatttttatc aatgaccagcatatcggtggctgtgatgaccttcacactctggaatttcagggtcagtta gacaatctgctcaaggcaagctga

DBGET integrated database retrieval system