Moorena producens: BJP34_10295 Help Entry BJP34_10295       CDS       T04499                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mpro  Moorena producens Pathway mpro00998   Biosynthesis of various antibiotics mpro01100   Metabolic pathways mpro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BJP34_10295    00074 Mycolic acid biosynthesis     BJP34_10295   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BJP34_10295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DNA_pol3_finger Motif Other DBs NCBI-ProteinID:  AOW99792 UniProt:  A0A1D8TQE3 LinkDB All DBs Position 2722904..2723179 Genome browser AA seq 91 aa AA seqDB search MLNSETVVKQLKEIIATEVDANLELEDIDENASLFEDGLGLDSLAIMQLITSIERHFWFR FTDDDISPDNFEDLTILSELITSKLTLYRQY NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgttaaactcagaaactgtagtcaagcaactcaaagaaattattgccacagaagtagat gccaatcttgagctagaagatattgatgaaaatgcctctctatttgaggatggattagga cttgactctctggcaattatgcaactaattacgtcaattgaaagacacttttggtttcga tttactgacgatgatatcagtccagataattttgaagacctcactattttatcggaatta attacgagtaaattaactctttacagacagtattaa

DBGET integrated database retrieval system