Metallosphaera prunae: DFR88_07105 Help Entry DFR88_07105       CDS       T05966                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mpru  Metallosphaera prunae Pathway mpru03010   Ribosome Brite KEGG Orthology (KO) [BR:mpru00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     DFR88_07105   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     DFR88_07105  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mpru03011]     DFR88_07105    04121 Ubiquitin system [BR:mpru04121]     DFR88_07105   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpru04147]     DFR88_07105 Ribosome [BR:mpru03011]  Ribosomal proteins   Eukaryotes    Small subunit     DFR88_07105   Archaea     DFR88_07105 Ubiquitin system [BR:mpru04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    DFR88_07105 Exosome [BR:mpru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    DFR88_07105   Exosomal proteins of colorectal cancer cells    DFR88_07105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_ribbon_SprT Cas12f1-like_TNB Zn_ribbon_Nudix DUF7479 Zn_ribbon_RPB9 Zn_ribbon_13 FlhC HalOD2 Lar_restr_allev YhfH Zn_ribbon_PriA Zn_ribbon_3 Zn_Ribbon_1 zf_UBZ zf-tcix Zn_ribbon_ISL3 Zn_ribbon_8 Motif Other DBs NCBI-ProteinID:  QCO31273 UniProt:  A0A4D8RWH5 LinkDB All DBs Position complement(1336006..1336191) Genome browser AA seq 61 aa AA seqDB search MAKGEQKASARLYYEIVDGKIKLKNKKCPKCGSVMAHHMKPRERWSCGRCGYTEFAGKSK A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt gtggctaagggagaacagaaggcatcagctaggttatattacgagattgtggatgggaaa ataaagctgaagaacaagaagtgcccaaagtgtggaagtgtcatggctcaccacatgaag ccaagggaaagatggtcatgtggtaggtgcggatatactgaatttgcgggtaaatctaag gcatga

DBGET integrated database retrieval system