KEGG   Mycolicibacterium psychrotolerans: MPSYJ_45030
Entry
MPSYJ_45030       CDS       T07008                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
mpsc  Mycolicibacterium psychrotolerans
Pathway
mpsc00770  Pantothenate and CoA biosynthesis
mpsc01100  Metabolic pathways
mpsc01240  Biosynthesis of cofactors
Module
mpsc_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mpsc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MPSYJ_45030 (coaD)
Enzymes [BR:mpsc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     MPSYJ_45030 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig Pantoate_ligase YceI ATP-sulfurylase
Other DBs
NCBI-ProteinID: BBX71042
UniProt: A0A7I7MGS4
LinkDB
Position
complement(4607753..4608229)
AA seq 158 aa
MSGAVCPGSFDPVTLGHIDIFERAAAQFDEVVVAILVNPAKKGMFDLDERIEMIVESTGH
LPNLRVESGQGLVVDFVKNRGLTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATTP
QYSFVSSSLAKEVATLGGDVSELLPAAVNARLQAKLRG
NT seq 477 nt   +upstreamnt  +downstreamnt
atgagcggagcggtgtgcccgggatccttcgatccggtgacgctggggcacatcgacatc
ttcgagcgcgctgccgcccagttcgacgaggtcgtggtcgcgattctggtcaacccggcc
aagaagggcatgttcgacctcgacgagcgcatcgagatgatcgtggagtccaccggccat
ctgccgaatctgcgggtggagtccggtcagggcctggtcgtggacttcgtcaagaatcgc
ggcctcaccgccatcgtcaagggtctgcgcacaggcaccgatttcgagtacgagctgcag
atggcgcagatgaacaagcacatcgccggtgtcgacacgttcttcgtcgccaccacgccg
cagtactcgttcgtgtcgtcgtcgctggccaaggaggtcgccacactgggcggcgacgtg
tccgagctgctgcccgccgccgtcaacgcccggttgcaagccaagctgcgcggttga

DBGET integrated database retrieval system