Mycobacterium pseudoshottsii: MPSD_47090 Help Entry MPSD_47090        CDS       T07300                                  Name (GenBank) hypothetical protein   KO K04093   chorismate mutase [EC:5.4.99.5] Organism mpse  Mycobacterium pseudoshottsii Pathway mpse00400   Phenylalanine, tyrosine and tryptophan biosynthesis mpse01100   Metabolic pathways mpse01110   Biosynthesis of secondary metabolites mpse01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:mpse00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     MPSD_47090 Enzymes [BR:mpse01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      MPSD_47090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Knl1_RWD_C Motif Other DBs NCBI-ProteinID:  BBA90027 LinkDB All DBs Position 5134926..5135198 Genome browser AA seq 90 aa AA seqDB search MNTETIDTEDLPSIDELREEIDRLDREILAAVKRRAEVSQAIGKARMASGGTRLVHNREM KVIERYSELGPEGKDLAILLLRLGRGRLGH NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaccgaaactatcgacactgaagatctccccagcattgacgagctgcgcgaagag atcgaccggttggaccgcgagatcctggccgcggtcaagcggcgcgccgaggtgtctcag gcgatcggcaaggcccggatggcctccggcggcacccgactggtgcacaaccgcgagatg aaggtcatcgagcgctacagcgagctgggacccgagggtaaagacctggcaattctgctt ttgcggttgggtagaggtcgactcggccactaa

DBGET integrated database retrieval system