Methylovulum psychrotolerans: CEK71_17175 Help Entry CEK71_17175       CDS       T04929                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mpsy  Methylovulum psychrotolerans Pathway mpsy01100   Metabolic pathways mpsy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpsy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CEK71_17175    00074 Mycolic acid biosynthesis     CEK71_17175   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CEK71_17175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ASF47658 UniProt:  A0A1Z4C292 LinkDB All DBs Position 3816286..3816516 Genome browser AA seq 76 aa AA seqDB search MSNIEERVKKIVSEQLGLKGEIATDASFVDDLGADSLDTVELVMALEEEFECEIPDEDAE KITTVQQAIDYVEKHV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtaacattgaagaacgcgtaaaaaagattgtttctgagcagttgggcctgaaagga gagattgcgaccgacgcttcgtttgtggacgatcttggtgctgattctttggatacagtt gagctcgtgatggcgcttgaagaagaattcgaatgtgaaattcctgacgaagacgctgaa aaaatcactaccgtccagcaagccatcgactatgtagaaaaacacgtctga

DBGET integrated database retrieval system