Methylibium petroleiphilum: Mpe_A0639 Help Entry Mpe_A0639         CDS       T00470                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mpt  Methylibium petroleiphilum Pathway mpt01100   Metabolic pathways mpt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mpe_A0639    00074 Mycolic acid biosynthesis     Mpe_A0639   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mpe_A0639 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 DUF1896 Motif Other DBs NCBI-ProteinID:  ABM93601 UniProt:  A2SDG2 LinkDB All DBs Position 674002..674241 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVAEGEVTNEKAFVADLGADSLDTVELVMALEDEFSIEIPDEEA EKITTVQLAIDYAKSHAKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgaagcacgcgtcaagaagatcatcgccgagcaactcggcgtggccgaa ggcgaggtcaccaatgaaaaagccttcgtcgccgatctgggcgcggattcgctggacacc gtggaactggtgatggcactcgaggacgagttcagcatcgagatccccgatgaagaggcg gagaagatcacgactgtgcagctcgcgatcgactacgccaagagtcacgccaaggcctga

DBGET integrated database retrieval system