KEGG   Methylibium petroleiphilum: Mpe_B0541
Entry
Mpe_B0541         CDS       T00470                                 

Name
(GenBank) methylmalonyl-CoA mutase
  KO
K20906  2-hydroxyisobutanoyl-CoA mutase large subunit [EC:5.4.99.64]
Organism
mpt  Methylibium petroleiphilum
Brite
KEGG Orthology (KO) [BR:mpt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mpe_B0541
Enzymes [BR:mpt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.64  2-hydroxyisobutanoyl-CoA mutase
     Mpe_B0541
SSDB
Motif
Pfam: MM_CoA_mutase REV
Other DBs
NCBI-ProteinID: ABM97311
UniProt: A2SP22
LinkDB
Position
RPME01:490848..492536
AA seq 562 aa
MTWLEPQIKSQLQSERKDWEANEVGAFLKKAPERKEQFHTIGDFPVQRTYTAADIADTPL
EDIGLPGRYPFTRGPYPTMYRSRTWTMRQIAGFGTGEDTNKRFKYLIAQGQTGISTDFDM
PTLMGYDSDHPMSDGEVGREGVAIDTLADMEALLADIDLEKISVSFTINPSAWILLAMYV
ALGEKRGYDLNKLSGTVQADILKEYMAQKEYIYPIAPSVRIVRDIITYSAKNLKRYNPIN
ISGYHISEAGSSPLQEAAFTLANLITYVNEVTETGMHVDEFAPRLAFFFVSQGDFFEEVA
KFRALRRCYAKIMKERFGAKNPESMRLRFHCQTAAATLTKPQYMVNVVRTSLQALSAVLG
GAQSLHTNGYDEAFAIPTEDAMKMALRTQQIIAEESGVADVIDPLGGSYYVEALTTEYEK
KIFEILEEVEKRGGTIKLIEQGWFQKQIADFAYETALRKQSGQKPVIGVNRFVENEEDVK
IEIHPYDNTTAERQISRTRRVRAERDEAKVQAMLDQLVAVAKDESQNLMPLTIELVKAGA
TMGDIVEKLKGIWGTYRETPVF
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgacctggcttgagccgcagataaagtcccaactccaatcggagcgcaaggactgggaa
gcgaacgaagtcggcgccttcttgaagaaggcgcccgagcgcaaggagcagttccacacg
atcggggacttcccggtccagcgcacctacaccgctgccgacatcgccgacacgccgctg
gaggacatcggtcttccggggcgctacccgttcacgcgcgggccctacccgacgatgtac
cgcagccgcacctggacgatgcgccagatcgccggcttcggcaccggcgaggacaccaac
aagcgcttcaagtatctgatcgcgcagggccagaccggcatctccaccgacttcgacatg
cccacgctgatgggctacgactccgaccacccgatgagcgacggcgaggtcggccgcgag
ggcgtggcgatcgacacgctggccgacatggaggcgctgctggccgacatcgacctcgag
aagatctcggtctcgttcacgatcaacccgagcgcctggatcctgctcgcgatgtacgtg
gcgctcggcgagaagcgcggctacgacctgaacaagctgtcgggcacggtgcaggccgac
atcctgaaggagtacatggcgcagaaggagtacatctacccgatcgcgccgtcggtgcgc
atcgtgcgcgacatcatcacctacagcgcgaagaacctgaagcgctacaacccgatcaac
atctcgggctaccacatcagcgaggccggctcgtcgccgctgcaggaggcggccttcacg
ctggccaacctgatcacctacgtgaacgaggtgacggagaccggcatgcacgtcgacgag
ttcgcgccgcgcctcgccttcttcttcgtgtcgcaaggtgacttcttcgaggaggtagcg
aagttccgcgccctacgtcgctgctacgcgaagatcatgaaggagcgcttcggcgcgaag
aaccccgagtcgatgcggctgcgctttcactgtcagaccgcggcggcgactttgaccaag
ccgcagtacatggtcaacgtcgtgcgtacgtcgctgcaggcgctgtcggccgtgctcggc
ggcgcgcagtcgctgcacaccaacggctacgacgaagccttcgcgatcccgaccgaggat
gcgatgaagatggcgctgcgcacgcagcagatcattgccgaggagagtggtgtcgccgac
gtgatcgacccgctgggtggcagctactacgtcgaggcgctgaccaccgagtacgagaag
aagatcttcgagatcctcgaggaagtcgagaagcgcggtggcaccatcaagctgatcgag
cagggctggttccagaagcagattgcggacttcgcttacgagaccgcgctgcgcaagcag
tccggccagaagccggtgatcggggtgaaccgcttcgtcgagaacgaagaggacgtcaag
atcgagatccacccgtacgacaacacgacggccgaacgccagatttcccgcacgcgccgc
gttcgcgccgagcgcgacgaggccaaggtgcaagcgatgctcgaccaactggtggctgtc
gccaaggacgagtcccagaacctgatgccgctgaccatcgaactggtgaaggccggcgca
acgatgggggacatcgtcgagaagctgaaggggatctggggtacctaccgcgagacgccg
gtcttctga

DBGET integrated database retrieval system