Mustela putorius furo (domestic ferret): 101671734 Help Entry 101671734         CDS       T07239                                  Name (RefSeq) histone H2B type 2-F   KO K11252   histone H2B Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04613   Neutrophil extracellular trap formation mpuf05034   Alcoholism mpuf05203   Viral carcinogenesis mpuf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpuf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101671734  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101671734   09163 Immune disease    05322 Systemic lupus erythematosus     101671734   09165 Substance dependence    05034 Alcoholism     101671734  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpuf03036]     101671734   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpuf04147]     101671734 Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101671734 Exosome [BR:mpuf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101671734 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  101671734 NCBI-ProteinID:  XP_004776892 UniProt:  A0A8U0NE45 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAQYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccagcaaagtcggctcctgctcccaagaaaggctctaagaaagctgttacc aaagtgcagaagaaggacggcaagaagcgcaagcgcagccgtaaggagagctattccgtt tacgtgtataaagtgttgaagcaggtgcacccggacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgccggcgaggcctcccga ctggcgcagtacaacaagcgctccaccatcacgtcgcgggagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagctcgaagtaa

DBGET integrated database retrieval system