Mustela putorius furo (domestic ferret): 101671838 Help Entry 101671838         CDS       T07239                                  Name (RefSeq) histone H2B type 1 isoform X1   KO K11252   histone H2B Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04613   Neutrophil extracellular trap formation mpuf05034   Alcoholism mpuf05203   Viral carcinogenesis mpuf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpuf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101671838  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101671838   09163 Immune disease    05322 Systemic lupus erythematosus     101671838   09165 Substance dependence    05034 Alcoholism     101671838  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpuf03036]     101671838   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpuf04147]     101671838 Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101671838 Exosome [BR:mpuf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101671838 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  101671838 NCBI-ProteinID:  XP_004778810 Ensembl:  ENSMPUG00000018614 UniProt:  M3Z4I3 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgaacccgcgaagtccgctccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc ctggcgcactacaacaagcgctcgaccatcacgtccagggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system