Mustela putorius furo (domestic ferret): 101673784 Help Entry 101673784         CDS       T07239                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf00480   Glutathione metabolism mpuf00980   Metabolism of xenobiotics by cytochrome P450 mpuf00982   Drug metabolism - cytochrome P450 mpuf00983   Drug metabolism - other enzymes mpuf01100   Metabolic pathways mpuf01524   Platinum drug resistance mpuf05200   Pathways in cancer mpuf05204   Chemical carcinogenesis - DNA adducts mpuf05215   Prostate cancer mpuf05225   Hepatocellular carcinoma mpuf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     101673784   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     101673784    00982 Drug metabolism - cytochrome P450     101673784    00983 Drug metabolism - other enzymes     101673784  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101673784    05204 Chemical carcinogenesis - DNA adducts     101673784   09162 Cancer: specific types    05225 Hepatocellular carcinoma     101673784    05215 Prostate cancer     101673784   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101673784   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     101673784  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mpuf02000]     101673784 Enzymes [BR:mpuf01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      101673784 Transporters [BR:mpuf02000]  Other transporters   Pores ion channels [TC:1]    101673784 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_N_2 GST_C_2 GST_N_3 Motif Other DBs NCBI-GeneID:  101673784 NCBI-ProteinID:  XP_004759771 Ensembl:  ENSMPUG00000004029 UniProt:  A0A8U0UPL9 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTKETWLQGPLKASCLYGQLPKFQDGD LTLYQSNAILRHLGRSLGLYGKDQREAALLDVVNDGVEDLRCKYVMLIYTNYEAGKEEYL KALPECLKPFEMLLSQNEGGQAFIVGSQISFADYNLLDLLLIHQVLSPSCLDSHPLLLAY VKRLSARPKLKAFLASPEHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccattgtctactttcctgtccgaggccgctgcgaggccatgcgcatg ctgctggcggaccagggccagagctggaaggaggaggtggtgaccaaggagacctggctg cagggcccgctcaaggcctcctgtctgtatgggcagctccctaagttccaggacggagac ctcaccctgtaccagtccaatgccatcctgcgacacctgggccgctccctggggctgtac gggaaggaccagcgggaggcggccctgctggacgtggtgaacgacggcgtggaggacctg cgctgcaaatacgtcatgctcatctacaccaactacgaggcagggaaggaggagtacttg aaggcactgccagagtgcctgaagccttttgagatgctgctgtcccagaacgaggggggc caggccttcatcgtgggcagccagatctccttcgccgactacaatctgctggacctgttg ctgattcaccaggtcctgtcccccagctgcctggactcccaccccctgctcttggcctat gtgaagcgcctcagcgcccggcccaagctcaaggccttcctggcctcccccgagcacgtg aaccgccccatcaacggcaatgggaagcagtga

DBGET integrated database retrieval system