Mustela putorius furo (domestic ferret): 101674110 Help Entry 101674110         CDS       T07239                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04060   Cytokine-cytokine receptor interaction mpuf04061   Viral protein interaction with cytokine and cytokine receptor mpuf04151   PI3K-Akt signaling pathway mpuf04625   C-type lectin receptor signaling pathway mpuf04630   JAK-STAT signaling pathway mpuf04658   Th1 and Th2 cell differentiation mpuf04659   Th17 cell differentiation mpuf04660   T cell receptor signaling pathway mpuf04672   Intestinal immune network for IgA production mpuf04940   Type I diabetes mellitus mpuf05135   Yersinia infection mpuf05142   Chagas disease mpuf05162   Measles mpuf05166   Human T-cell leukemia virus 1 infection mpuf05171   Coronavirus disease - COVID-19 mpuf05200   Pathways in cancer mpuf05320   Autoimmune thyroid disease mpuf05321   Inflammatory bowel disease mpuf05330   Allograft rejection mpuf05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101674110 (IL2)    04151 PI3K-Akt signaling pathway     101674110 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101674110 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     101674110 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101674110 (IL2)    04660 T cell receptor signaling pathway     101674110 (IL2)    04658 Th1 and Th2 cell differentiation     101674110 (IL2)    04659 Th17 cell differentiation     101674110 (IL2)    04672 Intestinal immune network for IgA production     101674110 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101674110 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101674110 (IL2)    05171 Coronavirus disease - COVID-19     101674110 (IL2)    05162 Measles     101674110 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     101674110 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     101674110 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     101674110 (IL2)    05321 Inflammatory bowel disease     101674110 (IL2)    05330 Allograft rejection     101674110 (IL2)    05332 Graft-versus-host disease     101674110 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     101674110 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101674110 (IL2)    00536 Glycosaminoglycan binding proteins [BR:mpuf00536]     101674110 (IL2) Cytokines and neuropeptides [BR:mpuf04052]  Cytokines   Interleukins    101674110 (IL2) Glycosaminoglycan binding proteins [BR:mpuf00536]  Heparan sulfate / Heparin   Cytokines    101674110 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Motif Other DBs NCBI-GeneID:  101674110 NCBI-ProteinID:  XP_004748030 Ensembl:  ENSMPUG00000017393 UniProt:  A3FBE6 Structure PDBPDBj LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MYKMQLLSCIVLTLALFANSAPTTSSSTKEAQQQLEQLLLDLQLLLNGVKNYESPRMLTF KFYMPKKATELTHLQCLAEELKLLEEVLYLAQSKNFHLTDIKELMSNINVTLLKLKGSET SFKCEYDDETVTITEFLNKWITFCQSIFSTLT NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtacaaaatgcaactcttgtcttgcatcgtactgactctcgcactcttcgcaaacagt gcacctactacttcaagctctacgaaggaagcacagcaacagctggagcaattgctgctg gacttacagttgctcttgaatggagttaaaaattatgagagccccaggatgctcacgttt aaattctacatgcccaagaaggccacagaattgactcatcttcaatgtctagcagaagaa ctcaaacttttggaggaagtgctatatttagctcaaagcaaaaactttcacttgacagac atcaaggaactaatgagcaatatcaatgtaacacttctgaaactaaagggatctgaaaca agtttcaaatgtgaatatgatgacgagacagtaaccattacagaatttctgaacaaatgg attactttttgtcaaagcatcttctcaacactgacttga

DBGET integrated database retrieval system