Mustela putorius furo (domestic ferret): 101674197 Help Entry 101674197         CDS       T07239                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04060   Cytokine-cytokine receptor interaction mpuf04061   Viral protein interaction with cytokine and cytokine receptor mpuf04062   Chemokine signaling pathway mpuf04620   Toll-like receptor signaling pathway mpuf04621   NOD-like receptor signaling pathway mpuf04623   Cytosolic DNA-sensing pathway mpuf04668   TNF signaling pathway mpuf05020   Prion disease mpuf05142   Chagas disease mpuf05163   Human cytomegalovirus infection mpuf05164   Influenza A mpuf05168   Herpes simplex virus 1 infection mpuf05323   Rheumatoid arthritis mpuf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     101674197 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101674197 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     101674197 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101674197 (CCL5)    04621 NOD-like receptor signaling pathway     101674197 (CCL5)    04623 Cytosolic DNA-sensing pathway     101674197 (CCL5)    04062 Chemokine signaling pathway     101674197 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     101674197 (CCL5)    05168 Herpes simplex virus 1 infection     101674197 (CCL5)    05163 Human cytomegalovirus infection     101674197 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     101674197 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     101674197 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     101674197 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101674197 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101674197 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:mpuf00536]     101674197 (CCL5) Cytokines and neuropeptides [BR:mpuf04052]  Cytokines   Chemokines    101674197 (CCL5) Glycosaminoglycan binding proteins [BR:mpuf00536]  Heparan sulfate / Heparin   Chemokines    101674197 (CCL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101674197 NCBI-ProteinID:  XP_004747198 UniProt:  A0A8U0MLY9 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search MIPSSTWLLFWKLPLWGTTLLLACLYKRASLGFRRPPPRFLRQPVALTQPPPTGTMKVSA VTFAVLLATAAFCAPASASPYASDTTPCCFAYISRRLPFTHIQEYFYTSSKCSMPAVVFV TRKHRQVCANPQKKWVRDHINSLEMS NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgataccaagcagtacgtggctgctgttttggaaactccccttgtgggggacgaccctt ctactggcctgcctctataaaagggccagcctcggcttcagaagacccccaccgaggttc ctgaggcagccggtggctctcacgcagcctccacccaccggtaccatgaaggtctccgca gttaccttcgcagtcctccttgccaccgccgccttctgcgctcctgcctctgcctcccca tatgcctcggacaccaccccctgctgctttgcctacatctcccgccgactgcccttcacc cacatccaggagtatttttacaccagcagcaagtgctccatgccagcggtcgtctttgtc acccggaagcaccgccaagtgtgtgccaacccacagaagaaatgggtgcgggaccacatc aactctttggagatgagttag

DBGET integrated database retrieval system