Mustela putorius furo (domestic ferret): 101674297 Help Entry 101674297         CDS       T07239                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf01521   EGFR tyrosine kinase inhibitor resistance mpuf01524   Platinum drug resistance mpuf04014   Ras signaling pathway mpuf04064   NF-kappa B signaling pathway mpuf04115   p53 signaling pathway mpuf04137   Mitophagy - animal mpuf04140   Autophagy - animal mpuf04151   PI3K-Akt signaling pathway mpuf04210   Apoptosis mpuf04215   Apoptosis - multiple species mpuf04621   NOD-like receptor signaling pathway mpuf04630   JAK-STAT signaling pathway mpuf05012   Parkinson disease mpuf05014   Amyotrophic lateral sclerosis mpuf05022   Pathways of neurodegeneration - multiple diseases mpuf05145   Toxoplasmosis mpuf05162   Measles mpuf05166   Human T-cell leukemia virus 1 infection mpuf05168   Herpes simplex virus 1 infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05200   Pathways in cancer mpuf05202   Transcriptional misregulation in cancer mpuf05212   Pancreatic cancer mpuf05220   Chronic myeloid leukemia mpuf05222   Small cell lung cancer mpuf05225   Hepatocellular carcinoma mpuf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101674297 (BCL2L1)    04630 JAK-STAT signaling pathway     101674297 (BCL2L1)    04064 NF-kappa B signaling pathway     101674297 (BCL2L1)    04151 PI3K-Akt signaling pathway     101674297 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101674297 (BCL2L1)    04137 Mitophagy - animal     101674297 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     101674297 (BCL2L1)    04215 Apoptosis - multiple species     101674297 (BCL2L1)    04115 p53 signaling pathway     101674297 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101674297 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101674297 (BCL2L1)    05202 Transcriptional misregulation in cancer     101674297 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     101674297 (BCL2L1)    05225 Hepatocellular carcinoma     101674297 (BCL2L1)    05220 Chronic myeloid leukemia     101674297 (BCL2L1)    05222 Small cell lung cancer     101674297 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101674297 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     101674297 (BCL2L1)    05162 Measles     101674297 (BCL2L1)    05168 Herpes simplex virus 1 infection     101674297 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     101674297 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     101674297 (BCL2L1)    05014 Amyotrophic lateral sclerosis     101674297 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     101674297 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101674297 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101674297 (BCL2L1)    01524 Platinum drug resistance     101674297 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mpuf01009]     101674297 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpuf03036]     101674297 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mpuf02000]     101674297 (BCL2L1) Protein phosphatases and associated proteins [BR:mpuf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      101674297 (BCL2L1) Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     101674297 (BCL2L1) Transporters [BR:mpuf02000]  Other transporters   Pores ion channels [TC:1]    101674297 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  101674297 NCBI-ProteinID:  XP_004746734 Ensembl:  ENSMPUG00000017901 UniProt:  M3Z2H9 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQALVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgcagaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtaaagcaagcgctgagggaggctggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatctcagcttcacatcaccccagggacagcgtat cagagctttgagcaggtggtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggctctgtgtgtggagagcgtagacaaggagatgcag gcattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system