Mustela putorius furo (domestic ferret): 101675380 Help Entry 101675380         CDS       T07239                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04010   MAPK signaling pathway mpuf04020   Calcium signaling pathway mpuf04022   cGMP-PKG signaling pathway mpuf04114   Oocyte meiosis mpuf04218   Cellular senescence mpuf04310   Wnt signaling pathway mpuf04360   Axon guidance mpuf04370   VEGF signaling pathway mpuf04380   Osteoclast differentiation mpuf04625   C-type lectin receptor signaling pathway mpuf04650   Natural killer cell mediated cytotoxicity mpuf04658   Th1 and Th2 cell differentiation mpuf04659   Th17 cell differentiation mpuf04660   T cell receptor signaling pathway mpuf04662   B cell receptor signaling pathway mpuf04720   Long-term potentiation mpuf04724   Glutamatergic synapse mpuf04921   Oxytocin signaling pathway mpuf04922   Glucagon signaling pathway mpuf04924   Renin secretion mpuf05010   Alzheimer disease mpuf05014   Amyotrophic lateral sclerosis mpuf05020   Prion disease mpuf05022   Pathways of neurodegeneration - multiple diseases mpuf05031   Amphetamine addiction mpuf05152   Tuberculosis mpuf05163   Human cytomegalovirus infection mpuf05166   Human T-cell leukemia virus 1 infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpuf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101675380 (PPP3R2)    04310 Wnt signaling pathway     101675380 (PPP3R2)    04370 VEGF signaling pathway     101675380 (PPP3R2)    04020 Calcium signaling pathway     101675380 (PPP3R2)    04022 cGMP-PKG signaling pathway     101675380 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101675380 (PPP3R2)    04218 Cellular senescence     101675380 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101675380 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     101675380 (PPP3R2)    04660 T cell receptor signaling pathway     101675380 (PPP3R2)    04658 Th1 and Th2 cell differentiation     101675380 (PPP3R2)    04659 Th17 cell differentiation     101675380 (PPP3R2)    04662 B cell receptor signaling pathway     101675380 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     101675380 (PPP3R2)    04921 Oxytocin signaling pathway     101675380 (PPP3R2)    04924 Renin secretion     101675380 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     101675380 (PPP3R2)    04720 Long-term potentiation     101675380 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     101675380 (PPP3R2)    04380 Osteoclast differentiation     101675380 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101675380 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101675380 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     101675380 (PPP3R2)    05163 Human cytomegalovirus infection     101675380 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     101675380 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     101675380 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     101675380 (PPP3R2)    05014 Amyotrophic lateral sclerosis     101675380 (PPP3R2)    05020 Prion disease     101675380 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     101675380 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     101675380 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101675380 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mpuf01009]     101675380 (PPP3R2) Protein phosphatases and associated proteins [BR:mpuf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101675380 (PPP3R2) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 USP32_N Toprim_3 Motif Other DBs NCBI-GeneID:  101675380 NCBI-ProteinID:  XP_004747779 UniProt:  A0A8U0MMC6 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPEEICSHFSSDEIKRLSKRFKKLDLDRSGSLSVEEFVSLPELHQNPLVQRVVD VFDTDGNGEVNFKEFILGTSQFSVRGDEEEKLRFAFSIYDIDKDGYISNGELFQVLKLMV GDNLEDWQLQQLVDKTIIVLDRDGDGKISFEEFSAVVRGLDVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagccagttacccggaggagatatgctcccacttcagctccgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggaccgttcaggctctctgagcgtg gaggagttcgtgtccctgcccgagctgcaccagaacccgttggtgcagcgagtggtcgac gtcttcgacaccgacggcaatggagaagtgaacttcaaggagttcatcctggggacctcc cagttcagcgtcaggggggacgaggaggagaagttgaggtttgcgttcagcatctatgac attgataaagatggctacatttccaacggggagctcttccaggtgctgaagctgatggtg ggcgacaacctggaggactggcagttacagcagttagtggacaaaaccatcatcgtcctg gatcgggatggagacgggaaaatatcctttgaggagttcagcgctgtggttagaggcctg gatgtccacaagaagttggtggtgattgtgtga

DBGET integrated database retrieval system