Mustela putorius furo (domestic ferret): 101675758 Help Entry 101675758         CDS       T07239                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04060   Cytokine-cytokine receptor interaction mpuf04151   PI3K-Akt signaling pathway mpuf04217   Necroptosis mpuf04620   Toll-like receptor signaling pathway mpuf04621   NOD-like receptor signaling pathway mpuf04622   RIG-I-like receptor signaling pathway mpuf04623   Cytosolic DNA-sensing pathway mpuf04630   JAK-STAT signaling pathway mpuf04650   Natural killer cell mediated cytotoxicity mpuf04936   Alcoholic liver disease mpuf05152   Tuberculosis mpuf05160   Hepatitis C mpuf05161   Hepatitis B mpuf05162   Measles mpuf05163   Human cytomegalovirus infection mpuf05164   Influenza A mpuf05165   Human papillomavirus infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05168   Herpes simplex virus 1 infection mpuf05169   Epstein-Barr virus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05171   Coronavirus disease - COVID-19 mpuf05200   Pathways in cancer mpuf05320   Autoimmune thyroid disease mpuf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     101675758    04151 PI3K-Akt signaling pathway     101675758   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101675758  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101675758  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101675758    04621 NOD-like receptor signaling pathway     101675758    04622 RIG-I-like receptor signaling pathway     101675758    04623 Cytosolic DNA-sensing pathway     101675758    04650 Natural killer cell mediated cytotoxicity     101675758  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101675758   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101675758    05161 Hepatitis B     101675758    05160 Hepatitis C     101675758    05171 Coronavirus disease - COVID-19     101675758    05164 Influenza A     101675758    05162 Measles     101675758    05168 Herpes simplex virus 1 infection     101675758    05163 Human cytomegalovirus infection     101675758    05167 Kaposi sarcoma-associated herpesvirus infection     101675758    05169 Epstein-Barr virus infection     101675758    05165 Human papillomavirus infection     101675758   09171 Infectious disease: bacterial    05152 Tuberculosis     101675758   09163 Immune disease    05320 Autoimmune thyroid disease     101675758   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101675758   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101675758  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101675758 Cytokines and neuropeptides [BR:mpuf04052]  Cytokines   Interferons    101675758 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon PORR Motif Other DBs NCBI-GeneID:  101675758 NCBI-ProteinID:  XP_004761868 Ensembl:  ENSMPUG00000019803 UniProt:  M3Z7W2 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MALSCSFLVALVVLSCHSLGSLGCDLPQNRGLLQWRALMLLRQMRRLSASSCDNYTNDFG FPQEVFDSKALQKSHALSVVHVMNQKTFHLFCTEASTAPWNTTLLEELCSGLSEQLDRLA ACPLLEVGVGELPLVNRDSILRNYFQRISLYLQEKQYSPCAWEMVRAEIMKPLYASIALH KRLRSRK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctatcctgttccttcttggtggccctggtggtgctcagctgccactcccttggc tctctgggatgtgacctgcctcagaaccgcggcctgctgcagtggagggccctgatgctc ctgcgacaaatgaggagactgtctgctagctcctgtgacaactatacaaacgactttggc ttcccacaggaggtgtttgacagcaaggcgctacagaagtctcacgccctctctgttgtc catgtgatgaaccagaagaccttccacctcttctgcacagaggcctcaactgctccttgg aacacgaccctcctggaggaattgtgctcaggactttctgagcagctggatcgcctggca gcctgtcctctgctggaggtgggagtaggagagctgcccctggtgaacagggactccatc ctgaggaactacttccagagaatctccctctatctgcaagagaagcaatacagcccttgt gcctgggagatggtccgagcagagatcatgaaacccttgtatgcatcaatagccttacat aagagactaaggagcaggaagtga

DBGET integrated database retrieval system