Mustela putorius furo (domestic ferret): 101676305 Help Entry 101676305         CDS       T07239                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04613   Neutrophil extracellular trap formation mpuf05034   Alcoholism mpuf05203   Viral carcinogenesis mpuf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpuf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101676305  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101676305   09163 Immune disease    05322 Systemic lupus erythematosus     101676305   09165 Substance dependence    05034 Alcoholism     101676305  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpuf03036]     101676305 Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101676305 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C Histone TAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP PAF TAF4 Ribosomal_S8e Motif Other DBs NCBI-GeneID:  101676305 NCBI-ProteinID:  XP_012904554 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTETRGVLKVFLENVI RDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacggcgcgcaagtcgaccggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggcccggcacggagacccgcggggtgctcaaggtgttcctggagaacgtgatc cgcgacgccgtcacctacacggagcacgccaagcgcaagacggtcacggccatggacgtg gtctacgcgctcaagcgccagggccgcaccctctacggcttcgggggctaa

DBGET integrated database retrieval system