Mustela putorius furo (domestic ferret): 101677962 Help Entry 101677962         CDS       T07239                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04015   Rap1 signaling pathway mpuf04810   Regulation of actin cytoskeleton mpuf05014   Amyotrophic lateral sclerosis mpuf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101677962 (PFN2)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101677962 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpuf04131]     101677962 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpuf04812]     101677962 (PFN2)    04147 Exosome [BR:mpuf04147]     101677962 (PFN2) Membrane trafficking [BR:mpuf04131]  Others   Actin-binding proteins    Others     101677962 (PFN2) Cytoskeleton proteins [BR:mpuf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101677962 (PFN2) Exosome [BR:mpuf04147]  Exosomal proteins   Proteins found in most exosomes    101677962 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101677962 NCBI-ProteinID:  XP_004755581 UniProt:  A0A8U0MTK2 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcggtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system