Mustela putorius furo (domestic ferret): 101677971 Help Entry 101677971         CDS       T07239                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mpuf  Mustela putorius furo (domestic ferret) Brite KEGG Orthology (KO) [BR:mpuf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mpuf03041]     101677971   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpuf04052]     101677971 Spliceosome [BR:mpuf03041]  Complex B   Other components    Complex B specific factors     101677971 Cytokines and neuropeptides [BR:mpuf04052]  Neuropeptides   Unclassified    101677971 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  101677971 NCBI-ProteinID:  XP_004757496 UniProt:  A0A8U0MV93 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MLLQQTFLSSGCLRFCWFQAFRAPDWMIEVVCNDRLGKKVRIKCNTDDTIGDLKKLIAAQ TGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgcttctgcagcaaacattccttagctcagggtgtctgaggttctgctggttccaggcg tttcgagctccagactggatgatcgaggttgtttgcaacgaccgtctagggaagaaggtc cgcattaagtgcaacactgatgacaccatcggggaccttaagaagctgatcgcagcccaa actggcacccgttggaacaagatcgtcctgaagaagtggtacacgatttttaaggaccac gtgtctctgggggactatgaaatccacgatgggatgaacctggagctttattaccagtag

DBGET integrated database retrieval system