Mustela putorius furo (domestic ferret): 101679168 Help Entry 101679168         CDS       T07239                                  Name (RefSeq) histone H2A type 2-C isoform X2   KO K11251   histone H2A Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf03082   ATP-dependent chromatin remodeling mpuf04217   Necroptosis mpuf04613   Neutrophil extracellular trap formation mpuf05034   Alcoholism mpuf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpuf00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     101679168  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     101679168  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101679168  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     101679168   09165 Substance dependence    05034 Alcoholism     101679168  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpuf03036]     101679168   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpuf04147]     101679168 Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101679168 Exosome [BR:mpuf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101679168 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  101679168 NCBI-ProteinID:  XP_004776889 UniProt:  M3Z3Z3 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcggtcgtct cgcgccggcctgcagttcccggtgggccgagtgcaccggctgctgcgcaagggcaactac gccgagcgggtgggggccggcgcgccggtgtacatggcggcggtgctggagtacctgacg gcggagatcctggagctggcggggaacgcggcccgagacaacaagaagacgcgcatcatc ccgcgccacctccagctggccatccgcaacgacgaggagctcaacaagctgttgggcaaa gtcaccatcgcccagggcggcgtcctgcccaacatccaggccgttctcttaccaaaaaaa actgaaagccacaaagccaaaagtaaataa

DBGET integrated database retrieval system