Mustela putorius furo (domestic ferret): 101679269 Help Entry 101679269         CDS       T07239                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04613   Neutrophil extracellular trap formation mpuf05034   Alcoholism mpuf05203   Viral carcinogenesis mpuf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpuf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101679269  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101679269   09163 Immune disease    05322 Systemic lupus erythematosus     101679269   09165 Substance dependence    05034 Alcoholism     101679269  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpuf03036]     101679269 Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101679269 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  101679269 NCBI-ProteinID:  XP_004778836 UniProt:  G9L0N9 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgtggcaaaggcgggaagggtctgggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcgggggctaa

DBGET integrated database retrieval system