KEGG   Mustela putorius furo (domestic ferret): 101679748
Entry
101679748         CDS       T07239                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mpuf  Mustela putorius furo (domestic ferret)
Pathway
mpuf01521  EGFR tyrosine kinase inhibitor resistance
mpuf01522  Endocrine resistance
mpuf01524  Platinum drug resistance
mpuf04010  MAPK signaling pathway
mpuf04012  ErbB signaling pathway
mpuf04014  Ras signaling pathway
mpuf04015  Rap1 signaling pathway
mpuf04022  cGMP-PKG signaling pathway
mpuf04024  cAMP signaling pathway
mpuf04062  Chemokine signaling pathway
mpuf04066  HIF-1 signaling pathway
mpuf04068  FoxO signaling pathway
mpuf04071  Sphingolipid signaling pathway
mpuf04072  Phospholipase D signaling pathway
mpuf04114  Oocyte meiosis
mpuf04140  Autophagy - animal
mpuf04148  Efferocytosis
mpuf04150  mTOR signaling pathway
mpuf04151  PI3K-Akt signaling pathway
mpuf04210  Apoptosis
mpuf04218  Cellular senescence
mpuf04261  Adrenergic signaling in cardiomyocytes
mpuf04270  Vascular smooth muscle contraction
mpuf04350  TGF-beta signaling pathway
mpuf04360  Axon guidance
mpuf04370  VEGF signaling pathway
mpuf04371  Apelin signaling pathway
mpuf04380  Osteoclast differentiation
mpuf04510  Focal adhesion
mpuf04520  Adherens junction
mpuf04540  Gap junction
mpuf04550  Signaling pathways regulating pluripotency of stem cells
mpuf04611  Platelet activation
mpuf04613  Neutrophil extracellular trap formation
mpuf04620  Toll-like receptor signaling pathway
mpuf04621  NOD-like receptor signaling pathway
mpuf04625  C-type lectin receptor signaling pathway
mpuf04650  Natural killer cell mediated cytotoxicity
mpuf04657  IL-17 signaling pathway
mpuf04658  Th1 and Th2 cell differentiation
mpuf04659  Th17 cell differentiation
mpuf04660  T cell receptor signaling pathway
mpuf04662  B cell receptor signaling pathway
mpuf04664  Fc epsilon RI signaling pathway
mpuf04666  Fc gamma R-mediated phagocytosis
mpuf04668  TNF signaling pathway
mpuf04713  Circadian entrainment
mpuf04720  Long-term potentiation
mpuf04722  Neurotrophin signaling pathway
mpuf04723  Retrograde endocannabinoid signaling
mpuf04724  Glutamatergic synapse
mpuf04725  Cholinergic synapse
mpuf04726  Serotonergic synapse
mpuf04730  Long-term depression
mpuf04810  Regulation of actin cytoskeleton
mpuf04910  Insulin signaling pathway
mpuf04912  GnRH signaling pathway
mpuf04914  Progesterone-mediated oocyte maturation
mpuf04915  Estrogen signaling pathway
mpuf04916  Melanogenesis
mpuf04917  Prolactin signaling pathway
mpuf04919  Thyroid hormone signaling pathway
mpuf04921  Oxytocin signaling pathway
mpuf04926  Relaxin signaling pathway
mpuf04928  Parathyroid hormone synthesis, secretion and action
mpuf04929  GnRH secretion
mpuf04930  Type II diabetes mellitus
mpuf04933  AGE-RAGE signaling pathway in diabetic complications
mpuf04934  Cushing syndrome
mpuf04935  Growth hormone synthesis, secretion and action
mpuf04960  Aldosterone-regulated sodium reabsorption
mpuf05010  Alzheimer disease
mpuf05020  Prion disease
mpuf05022  Pathways of neurodegeneration - multiple diseases
mpuf05034  Alcoholism
mpuf05132  Salmonella infection
mpuf05133  Pertussis
mpuf05135  Yersinia infection
mpuf05140  Leishmaniasis
mpuf05142  Chagas disease
mpuf05145  Toxoplasmosis
mpuf05152  Tuberculosis
mpuf05160  Hepatitis C
mpuf05161  Hepatitis B
mpuf05163  Human cytomegalovirus infection
mpuf05164  Influenza A
mpuf05165  Human papillomavirus infection
mpuf05166  Human T-cell leukemia virus 1 infection
mpuf05167  Kaposi sarcoma-associated herpesvirus infection
mpuf05170  Human immunodeficiency virus 1 infection
mpuf05171  Coronavirus disease - COVID-19
mpuf05200  Pathways in cancer
mpuf05203  Viral carcinogenesis
mpuf05205  Proteoglycans in cancer
mpuf05206  MicroRNAs in cancer
mpuf05207  Chemical carcinogenesis - receptor activation
mpuf05208  Chemical carcinogenesis - reactive oxygen species
mpuf05210  Colorectal cancer
mpuf05211  Renal cell carcinoma
mpuf05212  Pancreatic cancer
mpuf05213  Endometrial cancer
mpuf05214  Glioma
mpuf05215  Prostate cancer
mpuf05216  Thyroid cancer
mpuf05218  Melanoma
mpuf05219  Bladder cancer
mpuf05220  Chronic myeloid leukemia
mpuf05221  Acute myeloid leukemia
mpuf05223  Non-small cell lung cancer
mpuf05224  Breast cancer
mpuf05225  Hepatocellular carcinoma
mpuf05226  Gastric cancer
mpuf05230  Central carbon metabolism in cancer
mpuf05231  Choline metabolism in cancer
mpuf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpuf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpuf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101679748 (MAPK3)
   04012 ErbB signaling pathway
    101679748 (MAPK3)
   04014 Ras signaling pathway
    101679748 (MAPK3)
   04015 Rap1 signaling pathway
    101679748 (MAPK3)
   04350 TGF-beta signaling pathway
    101679748 (MAPK3)
   04370 VEGF signaling pathway
    101679748 (MAPK3)
   04371 Apelin signaling pathway
    101679748 (MAPK3)
   04668 TNF signaling pathway
    101679748 (MAPK3)
   04066 HIF-1 signaling pathway
    101679748 (MAPK3)
   04068 FoxO signaling pathway
    101679748 (MAPK3)
   04072 Phospholipase D signaling pathway
    101679748 (MAPK3)
   04071 Sphingolipid signaling pathway
    101679748 (MAPK3)
   04024 cAMP signaling pathway
    101679748 (MAPK3)
   04022 cGMP-PKG signaling pathway
    101679748 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101679748 (MAPK3)
   04150 mTOR signaling pathway
    101679748 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101679748 (MAPK3)
   04148 Efferocytosis
    101679748 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101679748 (MAPK3)
   04210 Apoptosis
    101679748 (MAPK3)
   04218 Cellular senescence
    101679748 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101679748 (MAPK3)
   04520 Adherens junction
    101679748 (MAPK3)
   04540 Gap junction
    101679748 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101679748 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101679748 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101679748 (MAPK3)
   04613 Neutrophil extracellular trap formation
    101679748 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101679748 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101679748 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    101679748 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101679748 (MAPK3)
   04660 T cell receptor signaling pathway
    101679748 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    101679748 (MAPK3)
   04659 Th17 cell differentiation
    101679748 (MAPK3)
   04657 IL-17 signaling pathway
    101679748 (MAPK3)
   04662 B cell receptor signaling pathway
    101679748 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101679748 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101679748 (MAPK3)
   04062 Chemokine signaling pathway
    101679748 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101679748 (MAPK3)
   04929 GnRH secretion
    101679748 (MAPK3)
   04912 GnRH signaling pathway
    101679748 (MAPK3)
   04915 Estrogen signaling pathway
    101679748 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101679748 (MAPK3)
   04917 Prolactin signaling pathway
    101679748 (MAPK3)
   04921 Oxytocin signaling pathway
    101679748 (MAPK3)
   04926 Relaxin signaling pathway
    101679748 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    101679748 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101679748 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    101679748 (MAPK3)
   04916 Melanogenesis
    101679748 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101679748 (MAPK3)
   04270 Vascular smooth muscle contraction
    101679748 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101679748 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101679748 (MAPK3)
   04725 Cholinergic synapse
    101679748 (MAPK3)
   04726 Serotonergic synapse
    101679748 (MAPK3)
   04720 Long-term potentiation
    101679748 (MAPK3)
   04730 Long-term depression
    101679748 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101679748 (MAPK3)
   04722 Neurotrophin signaling pathway
    101679748 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    101679748 (MAPK3)
   04380 Osteoclast differentiation
    101679748 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101679748 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101679748 (MAPK3)
   05206 MicroRNAs in cancer
    101679748 (MAPK3)
   05205 Proteoglycans in cancer
    101679748 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    101679748 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101679748 (MAPK3)
   05203 Viral carcinogenesis
    101679748 (MAPK3)
   05230 Central carbon metabolism in cancer
    101679748 (MAPK3)
   05231 Choline metabolism in cancer
    101679748 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101679748 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101679748 (MAPK3)
   05212 Pancreatic cancer
    101679748 (MAPK3)
   05225 Hepatocellular carcinoma
    101679748 (MAPK3)
   05226 Gastric cancer
    101679748 (MAPK3)
   05214 Glioma
    101679748 (MAPK3)
   05216 Thyroid cancer
    101679748 (MAPK3)
   05221 Acute myeloid leukemia
    101679748 (MAPK3)
   05220 Chronic myeloid leukemia
    101679748 (MAPK3)
   05218 Melanoma
    101679748 (MAPK3)
   05211 Renal cell carcinoma
    101679748 (MAPK3)
   05219 Bladder cancer
    101679748 (MAPK3)
   05215 Prostate cancer
    101679748 (MAPK3)
   05213 Endometrial cancer
    101679748 (MAPK3)
   05224 Breast cancer
    101679748 (MAPK3)
   05223 Non-small cell lung cancer
    101679748 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101679748 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    101679748 (MAPK3)
   05161 Hepatitis B
    101679748 (MAPK3)
   05160 Hepatitis C
    101679748 (MAPK3)
   05171 Coronavirus disease - COVID-19
    101679748 (MAPK3)
   05164 Influenza A
    101679748 (MAPK3)
   05163 Human cytomegalovirus infection
    101679748 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101679748 (MAPK3)
   05165 Human papillomavirus infection
    101679748 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101679748 (MAPK3)
   05135 Yersinia infection
    101679748 (MAPK3)
   05133 Pertussis
    101679748 (MAPK3)
   05152 Tuberculosis
    101679748 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101679748 (MAPK3)
   05140 Leishmaniasis
    101679748 (MAPK3)
   05142 Chagas disease
    101679748 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101679748 (MAPK3)
   05020 Prion disease
    101679748 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    101679748 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    101679748 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101679748 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101679748 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101679748 (MAPK3)
   04934 Cushing syndrome
    101679748 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101679748 (MAPK3)
   01524 Platinum drug resistance
    101679748 (MAPK3)
   01522 Endocrine resistance
    101679748 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpuf01001]
    101679748 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpuf03036]
    101679748 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpuf04147]
    101679748 (MAPK3)
Enzymes [BR:mpuf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101679748 (MAPK3)
Protein kinases [BR:mpuf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101679748 (MAPK3)
Chromosome and associated proteins [BR:mpuf03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101679748 (MAPK3)
Exosome [BR:mpuf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101679748 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 101679748
NCBI-ProteinID: XP_004774094
Ensembl: ENSMPUG00000012636
UniProt: A0A8U0NAE8
LinkDB
Position
Unknown
AA seq 358 aa
PGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSAYDHVRKVRVAIKKISPFEHQTY
CQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQLSND
HICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFL
TEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGIL
GSPSQEDLNCIINMKARNYLQSLPSKTKVAWSKLFPKSDSKALDLLDRMLTFNPNKRITV
EEALAHPYLEQYYDPSDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGAREAP
NT seq 1077 nt   +upstreamnt  +downstreamnt
ccgggggtctcgggggaggtggaggtggtgaaggggcagccgttcgacgtgggcccgcgc
tacacggagctgcattacatcggcgagggcgcgtacggcatggtcagctcagcttacgac
cacgtgcgcaaggttcgcgtggccatcaagaaaatcagccccttcgagcatcagacctac
tgccagcgcacactgcgagagatccagatcttactgcgcttccgccacgagaacgtcatt
ggcattcgggatattctgcgggcgcccaccctggaagccatgagggatgtctacattgtg
caggacctgatggagaccgacctctacaaactgctcaaaagccagcagctgagcaacgac
catatttgctacttcctctaccagatcctgcggggcctgaagtatatccactcggccaac
gtgctccaccgggatttgaagccctctaacctgctcatcaacaccacctgcgaccttaag
atctgcgattttggcctggcccggattgccgatcccgagcacgaccacactggcttcctg
acagagtatgtggccacacgctggtaccgggctccagaaatcatgcttaactctaagggc
tacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctccaac
cggcccatcttccctggcaagcactacctggaccagctcaaccacattctgggtatcctg
ggctccccgtcccaggaggacttgaactgtatcatcaacatgaaggcccggaactacctg
cagtctctgccctccaagaccaaggtggcctggtccaagcttttccccaagtccgactcc
aaagctcttgacctgctagaccggatgttgaccttcaaccccaacaaacgaatcacagtg
gaagaagccctggctcacccctacttggagcagtactacgatccaagtgatgagccagtg
gccgaggagcctttcaccttcgacatggagctggatgacctacccaaggagcggctgaag
gagctcatcttccaggagacagcccgcttccagcctggggcgcgggaggccccctaa

DBGET integrated database retrieval system