Mustela putorius furo (domestic ferret): 101679891 Help Entry 101679891         CDS       T07239                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04014   Ras signaling pathway mpuf04015   Rap1 signaling pathway mpuf04022   cGMP-PKG signaling pathway mpuf04024   cAMP signaling pathway mpuf04062   Chemokine signaling pathway mpuf04071   Sphingolipid signaling pathway mpuf04072   Phospholipase D signaling pathway mpuf04081   Hormone signaling mpuf04144   Endocytosis mpuf04150   mTOR signaling pathway mpuf04270   Vascular smooth muscle contraction mpuf04310   Wnt signaling pathway mpuf04350   TGF-beta signaling pathway mpuf04360   Axon guidance mpuf04510   Focal adhesion mpuf04520   Adherens junction mpuf04530   Tight junction mpuf04611   Platelet activation mpuf04621   NOD-like receptor signaling pathway mpuf04625   C-type lectin receptor signaling pathway mpuf04660   T cell receptor signaling pathway mpuf04670   Leukocyte transendothelial migration mpuf04722   Neurotrophin signaling pathway mpuf04810   Regulation of actin cytoskeleton mpuf04921   Oxytocin signaling pathway mpuf04928   Parathyroid hormone synthesis, secretion and action mpuf04972   Pancreatic secretion mpuf05100   Bacterial invasion of epithelial cells mpuf05132   Salmonella infection mpuf05133   Pertussis mpuf05135   Yersinia infection mpuf05152   Tuberculosis mpuf05163   Human cytomegalovirus infection mpuf05200   Pathways in cancer mpuf05203   Viral carcinogenesis mpuf05205   Proteoglycans in cancer mpuf05206   MicroRNAs in cancer mpuf05210   Colorectal cancer mpuf05417   Lipid and atherosclerosis mpuf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101679891 (RHOA)    04015 Rap1 signaling pathway     101679891 (RHOA)    04310 Wnt signaling pathway     101679891 (RHOA)    04350 TGF-beta signaling pathway     101679891 (RHOA)    04072 Phospholipase D signaling pathway     101679891 (RHOA)    04071 Sphingolipid signaling pathway     101679891 (RHOA)    04024 cAMP signaling pathway     101679891 (RHOA)    04022 cGMP-PKG signaling pathway     101679891 (RHOA)    04150 mTOR signaling pathway     101679891 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     101679891 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     101679891 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101679891 (RHOA)    04520 Adherens junction     101679891 (RHOA)    04530 Tight junction     101679891 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101679891 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     101679891 (RHOA)    04621 NOD-like receptor signaling pathway     101679891 (RHOA)    04625 C-type lectin receptor signaling pathway     101679891 (RHOA)    04660 T cell receptor signaling pathway     101679891 (RHOA)    04670 Leukocyte transendothelial migration     101679891 (RHOA)    04062 Chemokine signaling pathway     101679891 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     101679891 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     101679891 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     101679891 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     101679891 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101679891 (RHOA)   09158 Development and regeneration    04360 Axon guidance     101679891 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101679891 (RHOA)    05206 MicroRNAs in cancer     101679891 (RHOA)    05205 Proteoglycans in cancer     101679891 (RHOA)    05203 Viral carcinogenesis     101679891 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     101679891 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     101679891 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101679891 (RHOA)    05135 Yersinia infection     101679891 (RHOA)    05133 Pertussis     101679891 (RHOA)    05152 Tuberculosis     101679891 (RHOA)    05100 Bacterial invasion of epithelial cells     101679891 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101679891 (RHOA)    05418 Fluid shear stress and atherosclerosis     101679891 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpuf04131]     101679891 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpuf04147]     101679891 (RHOA)    04031 GTP-binding proteins [BR:mpuf04031]     101679891 (RHOA) Membrane trafficking [BR:mpuf04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     101679891 (RHOA) Exosome [BR:mpuf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101679891 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    101679891 (RHOA)   Exosomal proteins of colorectal cancer cells    101679891 (RHOA)   Exosomal proteins of bladder cancer cells    101679891 (RHOA) GTP-binding proteins [BR:mpuf04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     101679891 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  101679891 NCBI-ProteinID:  XP_004760714 Ensembl:  ENSMPUG00000013840 UniProt:  M3YQX8 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgt ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca gctgggcaggaagattatgaccgcttgaggcctctctcctatccggacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaatatcccagaaaaatggacc ccggaagtcaagcacttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgagcacacaaggcgggaactagccaagatgaagcaggagccggtgaaa cctgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system