KEGG   Mustela putorius furo (domestic ferret): 101681333
Entry
101681333         CDS       T07239                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X3
  KO
K07827  GTPase KRas
Organism
mpuf  Mustela putorius furo (domestic ferret)
Pathway
mpuf01521  EGFR tyrosine kinase inhibitor resistance
mpuf01522  Endocrine resistance
mpuf04010  MAPK signaling pathway
mpuf04012  ErbB signaling pathway
mpuf04014  Ras signaling pathway
mpuf04015  Rap1 signaling pathway
mpuf04062  Chemokine signaling pathway
mpuf04068  FoxO signaling pathway
mpuf04071  Sphingolipid signaling pathway
mpuf04072  Phospholipase D signaling pathway
mpuf04137  Mitophagy - animal
mpuf04140  Autophagy - animal
mpuf04150  mTOR signaling pathway
mpuf04151  PI3K-Akt signaling pathway
mpuf04210  Apoptosis
mpuf04211  Longevity regulating pathway
mpuf04213  Longevity regulating pathway - multiple species
mpuf04218  Cellular senescence
mpuf04360  Axon guidance
mpuf04370  VEGF signaling pathway
mpuf04371  Apelin signaling pathway
mpuf04540  Gap junction
mpuf04550  Signaling pathways regulating pluripotency of stem cells
mpuf04625  C-type lectin receptor signaling pathway
mpuf04650  Natural killer cell mediated cytotoxicity
mpuf04660  T cell receptor signaling pathway
mpuf04662  B cell receptor signaling pathway
mpuf04664  Fc epsilon RI signaling pathway
mpuf04714  Thermogenesis
mpuf04720  Long-term potentiation
mpuf04722  Neurotrophin signaling pathway
mpuf04725  Cholinergic synapse
mpuf04726  Serotonergic synapse
mpuf04730  Long-term depression
mpuf04810  Regulation of actin cytoskeleton
mpuf04910  Insulin signaling pathway
mpuf04912  GnRH signaling pathway
mpuf04914  Progesterone-mediated oocyte maturation
mpuf04915  Estrogen signaling pathway
mpuf04916  Melanogenesis
mpuf04917  Prolactin signaling pathway
mpuf04919  Thyroid hormone signaling pathway
mpuf04921  Oxytocin signaling pathway
mpuf04926  Relaxin signaling pathway
mpuf04929  GnRH secretion
mpuf04933  AGE-RAGE signaling pathway in diabetic complications
mpuf04935  Growth hormone synthesis, secretion and action
mpuf04960  Aldosterone-regulated sodium reabsorption
mpuf05010  Alzheimer disease
mpuf05022  Pathways of neurodegeneration - multiple diseases
mpuf05034  Alcoholism
mpuf05160  Hepatitis C
mpuf05161  Hepatitis B
mpuf05163  Human cytomegalovirus infection
mpuf05165  Human papillomavirus infection
mpuf05166  Human T-cell leukemia virus 1 infection
mpuf05167  Kaposi sarcoma-associated herpesvirus infection
mpuf05170  Human immunodeficiency virus 1 infection
mpuf05200  Pathways in cancer
mpuf05203  Viral carcinogenesis
mpuf05205  Proteoglycans in cancer
mpuf05206  MicroRNAs in cancer
mpuf05207  Chemical carcinogenesis - receptor activation
mpuf05208  Chemical carcinogenesis - reactive oxygen species
mpuf05210  Colorectal cancer
mpuf05211  Renal cell carcinoma
mpuf05212  Pancreatic cancer
mpuf05213  Endometrial cancer
mpuf05214  Glioma
mpuf05215  Prostate cancer
mpuf05216  Thyroid cancer
mpuf05218  Melanoma
mpuf05219  Bladder cancer
mpuf05220  Chronic myeloid leukemia
mpuf05221  Acute myeloid leukemia
mpuf05223  Non-small cell lung cancer
mpuf05224  Breast cancer
mpuf05225  Hepatocellular carcinoma
mpuf05226  Gastric cancer
mpuf05230  Central carbon metabolism in cancer
mpuf05231  Choline metabolism in cancer
mpuf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpuf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpuf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101681333 (KRAS)
   04012 ErbB signaling pathway
    101681333 (KRAS)
   04014 Ras signaling pathway
    101681333 (KRAS)
   04015 Rap1 signaling pathway
    101681333 (KRAS)
   04370 VEGF signaling pathway
    101681333 (KRAS)
   04371 Apelin signaling pathway
    101681333 (KRAS)
   04068 FoxO signaling pathway
    101681333 (KRAS)
   04072 Phospholipase D signaling pathway
    101681333 (KRAS)
   04071 Sphingolipid signaling pathway
    101681333 (KRAS)
   04151 PI3K-Akt signaling pathway
    101681333 (KRAS)
   04150 mTOR signaling pathway
    101681333 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101681333 (KRAS)
   04137 Mitophagy - animal
    101681333 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101681333 (KRAS)
   04218 Cellular senescence
    101681333 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101681333 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101681333 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101681333 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101681333 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    101681333 (KRAS)
   04660 T cell receptor signaling pathway
    101681333 (KRAS)
   04662 B cell receptor signaling pathway
    101681333 (KRAS)
   04664 Fc epsilon RI signaling pathway
    101681333 (KRAS)
   04062 Chemokine signaling pathway
    101681333 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101681333 (KRAS)
   04929 GnRH secretion
    101681333 (KRAS)
   04912 GnRH signaling pathway
    101681333 (KRAS)
   04915 Estrogen signaling pathway
    101681333 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    101681333 (KRAS)
   04917 Prolactin signaling pathway
    101681333 (KRAS)
   04921 Oxytocin signaling pathway
    101681333 (KRAS)
   04926 Relaxin signaling pathway
    101681333 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    101681333 (KRAS)
   04919 Thyroid hormone signaling pathway
    101681333 (KRAS)
   04916 Melanogenesis
    101681333 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101681333 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101681333 (KRAS)
   04726 Serotonergic synapse
    101681333 (KRAS)
   04720 Long-term potentiation
    101681333 (KRAS)
   04730 Long-term depression
    101681333 (KRAS)
   04722 Neurotrophin signaling pathway
    101681333 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101681333 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101681333 (KRAS)
   04213 Longevity regulating pathway - multiple species
    101681333 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101681333 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101681333 (KRAS)
   05206 MicroRNAs in cancer
    101681333 (KRAS)
   05205 Proteoglycans in cancer
    101681333 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    101681333 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    101681333 (KRAS)
   05203 Viral carcinogenesis
    101681333 (KRAS)
   05230 Central carbon metabolism in cancer
    101681333 (KRAS)
   05231 Choline metabolism in cancer
    101681333 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101681333 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101681333 (KRAS)
   05212 Pancreatic cancer
    101681333 (KRAS)
   05225 Hepatocellular carcinoma
    101681333 (KRAS)
   05226 Gastric cancer
    101681333 (KRAS)
   05214 Glioma
    101681333 (KRAS)
   05216 Thyroid cancer
    101681333 (KRAS)
   05221 Acute myeloid leukemia
    101681333 (KRAS)
   05220 Chronic myeloid leukemia
    101681333 (KRAS)
   05218 Melanoma
    101681333 (KRAS)
   05211 Renal cell carcinoma
    101681333 (KRAS)
   05219 Bladder cancer
    101681333 (KRAS)
   05215 Prostate cancer
    101681333 (KRAS)
   05213 Endometrial cancer
    101681333 (KRAS)
   05224 Breast cancer
    101681333 (KRAS)
   05223 Non-small cell lung cancer
    101681333 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101681333 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    101681333 (KRAS)
   05161 Hepatitis B
    101681333 (KRAS)
   05160 Hepatitis C
    101681333 (KRAS)
   05163 Human cytomegalovirus infection
    101681333 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101681333 (KRAS)
   05165 Human papillomavirus infection
    101681333 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101681333 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101681333 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    101681333 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101681333 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101681333 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101681333 (KRAS)
   01522 Endocrine resistance
    101681333 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpuf04131]
    101681333 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mpuf04031]
    101681333 (KRAS)
Membrane trafficking [BR:mpuf04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101681333 (KRAS)
GTP-binding proteins [BR:mpuf04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101681333 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase NPR1_interact ATP_bind_1 FeoB_N
Other DBs
NCBI-GeneID: 101681333
NCBI-ProteinID: XP_004776444
LinkDB
Position
Unknown
AA seq 227 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKINKEEKTPGC
VKIKKCIVMGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKCIIM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgagtatgatcctacaatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcaacaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgggtgttgatgatgccttctatacattagttcga
gaaattcgaaaacataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaagtca
aagacaaagtgtataattatgtaa

DBGET integrated database retrieval system