Mustela putorius furo (domestic ferret): 101681446 Help Entry 101681446         CDS       T07239                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04014   Ras signaling pathway mpuf04015   Rap1 signaling pathway mpuf04020   Calcium signaling pathway mpuf04022   cGMP-PKG signaling pathway mpuf04024   cAMP signaling pathway mpuf04070   Phosphatidylinositol signaling system mpuf04114   Oocyte meiosis mpuf04218   Cellular senescence mpuf04261   Adrenergic signaling in cardiomyocytes mpuf04270   Vascular smooth muscle contraction mpuf04371   Apelin signaling pathway mpuf04625   C-type lectin receptor signaling pathway mpuf04713   Circadian entrainment mpuf04720   Long-term potentiation mpuf04722   Neurotrophin signaling pathway mpuf04728   Dopaminergic synapse mpuf04740   Olfactory transduction mpuf04744   Phototransduction mpuf04750   Inflammatory mediator regulation of TRP channels mpuf04910   Insulin signaling pathway mpuf04912   GnRH signaling pathway mpuf04915   Estrogen signaling pathway mpuf04916   Melanogenesis mpuf04921   Oxytocin signaling pathway mpuf04922   Glucagon signaling pathway mpuf04924   Renin secretion mpuf04925   Aldosterone synthesis and secretion mpuf04970   Salivary secretion mpuf04971   Gastric acid secretion mpuf05010   Alzheimer disease mpuf05012   Parkinson disease mpuf05022   Pathways of neurodegeneration - multiple diseases mpuf05031   Amphetamine addiction mpuf05034   Alcoholism mpuf05133   Pertussis mpuf05152   Tuberculosis mpuf05163   Human cytomegalovirus infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05200   Pathways in cancer mpuf05214   Glioma mpuf05417   Lipid and atherosclerosis mpuf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101681446    04015 Rap1 signaling pathway     101681446    04371 Apelin signaling pathway     101681446    04020 Calcium signaling pathway     101681446    04070 Phosphatidylinositol signaling system     101681446    04024 cAMP signaling pathway     101681446    04022 cGMP-PKG signaling pathway     101681446  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101681446    04218 Cellular senescence     101681446  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101681446   09152 Endocrine system    04910 Insulin signaling pathway     101681446    04922 Glucagon signaling pathway     101681446    04912 GnRH signaling pathway     101681446    04915 Estrogen signaling pathway     101681446    04921 Oxytocin signaling pathway     101681446    04916 Melanogenesis     101681446    04924 Renin secretion     101681446    04925 Aldosterone synthesis and secretion     101681446   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101681446    04270 Vascular smooth muscle contraction     101681446   09154 Digestive system    04970 Salivary secretion     101681446    04971 Gastric acid secretion     101681446   09156 Nervous system    04728 Dopaminergic synapse     101681446    04720 Long-term potentiation     101681446    04722 Neurotrophin signaling pathway     101681446   09157 Sensory system    04744 Phototransduction     101681446    04740 Olfactory transduction     101681446    04750 Inflammatory mediator regulation of TRP channels     101681446   09159 Environmental adaptation    04713 Circadian entrainment     101681446  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101681446   09162 Cancer: specific types    05214 Glioma     101681446   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101681446    05163 Human cytomegalovirus infection     101681446    05167 Kaposi sarcoma-associated herpesvirus infection     101681446   09171 Infectious disease: bacterial    05133 Pertussis     101681446    05152 Tuberculosis     101681446   09164 Neurodegenerative disease    05010 Alzheimer disease     101681446    05012 Parkinson disease     101681446    05022 Pathways of neurodegeneration - multiple diseases     101681446   09165 Substance dependence    05031 Amphetamine addiction     101681446    05034 Alcoholism     101681446   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101681446    05418 Fluid shear stress and atherosclerosis     101681446  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mpuf01009]     101681446   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpuf04131]     101681446    03036 Chromosome and associated proteins [BR:mpuf03036]     101681446   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpuf04147]     101681446 Protein phosphatases and associated proteins [BR:mpuf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101681446 Membrane trafficking [BR:mpuf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     101681446 Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      101681446 Exosome [BR:mpuf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101681446 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 SPARC_Ca_bdg UPF0154 Dockerin_1 EF_EFCAB10_C EH EF-hand_11 Temptin_C EF-hand_EFHB_C Caleosin EF-hand_STIM1 EFhand_Ca_insen DUF5580_M SurA_N_3 DUF1103 Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  101681446 NCBI-ProteinID:  XP_004757981 Ensembl:  ENSMPUG00000019576 UniProt:  M3Z785 A0A8U0SXL3 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLSEEQVAEFKEAFCLFDKDGDGVITTQELGTVMRSLGQNPTEAELRDMVSEIDRDG NGTVDFPEFLGMMARQLKGRDSEDQIREAFRVFDKDGNGLVSATELRHVMTRLGEKLSDE EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgagcgaggaacaggtggccgagttcaaggaggccttctgcctgttt gacaaggacggggacggcgtcatcaccacccaggagctgggcaccgtcatgcgctccctg ggccagaaccccacggaggccgagctgcgcgacatggtcagcgagatcgaccgcgacggc aacggcaccgtggacttccccgagttcctgggcatgatggccaggcagctgaagggcagg gacagcgaggaccagatccgcgaggccttccgcgtcttcgacaaggacggcaacgggctg gtgagtgccacggagctgcggcacgtgatgaccaggctgggggagaagctgagcgacgag gaggtggacgagatgatccgggctgcggacgtggacggggatgggcaggtgaactacgag gagttcgtccacatgctggtctccaagtga

DBGET integrated database retrieval system