KEGG   Mustela putorius furo (domestic ferret): 101681446
Entry
101681446         CDS       T07239                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
mpuf  Mustela putorius furo (domestic ferret)
Pathway
mpuf04014  Ras signaling pathway
mpuf04015  Rap1 signaling pathway
mpuf04020  Calcium signaling pathway
mpuf04022  cGMP-PKG signaling pathway
mpuf04024  cAMP signaling pathway
mpuf04070  Phosphatidylinositol signaling system
mpuf04114  Oocyte meiosis
mpuf04218  Cellular senescence
mpuf04261  Adrenergic signaling in cardiomyocytes
mpuf04270  Vascular smooth muscle contraction
mpuf04371  Apelin signaling pathway
mpuf04625  C-type lectin receptor signaling pathway
mpuf04713  Circadian entrainment
mpuf04720  Long-term potentiation
mpuf04722  Neurotrophin signaling pathway
mpuf04728  Dopaminergic synapse
mpuf04740  Olfactory transduction
mpuf04744  Phototransduction
mpuf04750  Inflammatory mediator regulation of TRP channels
mpuf04910  Insulin signaling pathway
mpuf04912  GnRH signaling pathway
mpuf04915  Estrogen signaling pathway
mpuf04916  Melanogenesis
mpuf04921  Oxytocin signaling pathway
mpuf04922  Glucagon signaling pathway
mpuf04924  Renin secretion
mpuf04925  Aldosterone synthesis and secretion
mpuf04970  Salivary secretion
mpuf04971  Gastric acid secretion
mpuf05010  Alzheimer disease
mpuf05012  Parkinson disease
mpuf05022  Pathways of neurodegeneration - multiple diseases
mpuf05031  Amphetamine addiction
mpuf05034  Alcoholism
mpuf05133  Pertussis
mpuf05152  Tuberculosis
mpuf05163  Human cytomegalovirus infection
mpuf05167  Kaposi sarcoma-associated herpesvirus infection
mpuf05170  Human immunodeficiency virus 1 infection
mpuf05200  Pathways in cancer
mpuf05214  Glioma
mpuf05417  Lipid and atherosclerosis
mpuf05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpuf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101681446
   04015 Rap1 signaling pathway
    101681446
   04371 Apelin signaling pathway
    101681446
   04020 Calcium signaling pathway
    101681446
   04070 Phosphatidylinositol signaling system
    101681446
   04024 cAMP signaling pathway
    101681446
   04022 cGMP-PKG signaling pathway
    101681446
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101681446
   04218 Cellular senescence
    101681446
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101681446
  09152 Endocrine system
   04910 Insulin signaling pathway
    101681446
   04922 Glucagon signaling pathway
    101681446
   04912 GnRH signaling pathway
    101681446
   04915 Estrogen signaling pathway
    101681446
   04921 Oxytocin signaling pathway
    101681446
   04916 Melanogenesis
    101681446
   04924 Renin secretion
    101681446
   04925 Aldosterone synthesis and secretion
    101681446
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101681446
   04270 Vascular smooth muscle contraction
    101681446
  09154 Digestive system
   04970 Salivary secretion
    101681446
   04971 Gastric acid secretion
    101681446
  09156 Nervous system
   04728 Dopaminergic synapse
    101681446
   04720 Long-term potentiation
    101681446
   04722 Neurotrophin signaling pathway
    101681446
  09157 Sensory system
   04744 Phototransduction
    101681446
   04740 Olfactory transduction
    101681446
   04750 Inflammatory mediator regulation of TRP channels
    101681446
  09159 Environmental adaptation
   04713 Circadian entrainment
    101681446
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101681446
  09162 Cancer: specific types
   05214 Glioma
    101681446
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101681446
   05163 Human cytomegalovirus infection
    101681446
   05167 Kaposi sarcoma-associated herpesvirus infection
    101681446
  09171 Infectious disease: bacterial
   05133 Pertussis
    101681446
   05152 Tuberculosis
    101681446
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101681446
   05012 Parkinson disease
    101681446
   05022 Pathways of neurodegeneration - multiple diseases
    101681446
  09165 Substance dependence
   05031 Amphetamine addiction
    101681446
   05034 Alcoholism
    101681446
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101681446
   05418 Fluid shear stress and atherosclerosis
    101681446
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpuf01009]
    101681446
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpuf04131]
    101681446
   03036 Chromosome and associated proteins [BR:mpuf03036]
    101681446
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpuf04147]
    101681446
Protein phosphatases and associated proteins [BR:mpuf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101681446
Membrane trafficking [BR:mpuf04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    101681446
Chromosome and associated proteins [BR:mpuf03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     101681446
Exosome [BR:mpuf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101681446
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 SPARC_Ca_bdg UPF0154 Dockerin_1 EF_EFCAB10_C EH EF-hand_11 Temptin_C EF-hand_EFHB_C Caleosin EF-hand_STIM1 EFhand_Ca_insen DUF5580_M SurA_N_3 DUF1103 Fe_hyd_lg_C
Other DBs
NCBI-GeneID: 101681446
NCBI-ProteinID: XP_004757981
Ensembl: ENSMPUG00000019576
UniProt: M3Z785 A0A8U0SXL3
LinkDB
Position
Unknown
AA seq 149 aa
MADQLSEEQVAEFKEAFCLFDKDGDGVITTQELGTVMRSLGQNPTEAELRDMVSEIDRDG
NGTVDFPEFLGMMARQLKGRDSEDQIREAFRVFDKDGNGLVSATELRHVMTRLGEKLSDE
EVDEMIRAADVDGDGQVNYEEFVHMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgaccagctgagcgaggaacaggtggccgagttcaaggaggccttctgcctgttt
gacaaggacggggacggcgtcatcaccacccaggagctgggcaccgtcatgcgctccctg
ggccagaaccccacggaggccgagctgcgcgacatggtcagcgagatcgaccgcgacggc
aacggcaccgtggacttccccgagttcctgggcatgatggccaggcagctgaagggcagg
gacagcgaggaccagatccgcgaggccttccgcgtcttcgacaaggacggcaacgggctg
gtgagtgccacggagctgcggcacgtgatgaccaggctgggggagaagctgagcgacgag
gaggtggacgagatgatccgggctgcggacgtggacggggatgggcaggtgaactacgag
gagttcgtccacatgctggtctccaagtga

DBGET integrated database retrieval system