Mustela putorius furo (domestic ferret): 101682549 Help Entry 101682549         CDS       T07239                                  Symbol DCTN3 Name (RefSeq) dynactin subunit 3 isoform X2   KO K10425   dynactin 3 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04145   Phagocytosis mpuf04814   Motor proteins mpuf05014   Amyotrophic lateral sclerosis mpuf05016   Huntington disease mpuf05022   Pathways of neurodegeneration - multiple diseases mpuf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpuf00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     101682549 (DCTN3)   09142 Cell motility    04814 Motor proteins     101682549 (DCTN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101682549 (DCTN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101682549 (DCTN3)    05016 Huntington disease     101682549 (DCTN3)    05022 Pathways of neurodegeneration - multiple diseases     101682549 (DCTN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpuf03036]     101682549 (DCTN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpuf04812]     101682549 (DCTN3) Chromosome and associated proteins [BR:mpuf03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      101682549 (DCTN3) Cytoskeleton proteins [BR:mpuf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      101682549 (DCTN3) SSDB OrthologParalogGFIT Motif Pfam:  Dynactin_p22 Rem Spidroin_MaSp Motif Other DBs NCBI-GeneID:  101682549 NCBI-ProteinID:  XP_004747498 Ensembl:  ENSMPUG00000004267 UniProt:  A0A8U0MMD7 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MAAVTDVQRLQARVEELERWVYGSGGPRGSRKVADGLVKVQVALGNIASKRERVKILYKK IEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQIALLEQVEALVPMLDSAHIKAVP EHAARLQRLAQIHIQQQMEDLSTPSFKLLFSP NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcggctgtgaccgatgtgcagcggctacaggcccgtgtggaggaactggagcgctgg gtgtatgggtcgggcgggccgcgcggctcgcggaaggtggctgatggcctagtcaaggta caggtggctttggggaacattgccagcaagagggagagagtgaagattctgtacaaaaag attgaagacctgatcaaatatctggatcctgaatacattgaccgcattgccatacctgat gcctctaagctgcagttcatattagcagaggagcagtttatcttatcccagattgcactc ctggagcaggtggaggctttggtgcccatgctggacagcgctcacatcaaagctgttcct gagcatgctgcccgcctgcagcgcttggcccagatccacatccagcagcagatggaagat ctctccactccctcattcaagctcttgttctcaccttga

DBGET integrated database retrieval system