Mustela putorius furo (domestic ferret): 101683038 Help Entry 101683038         CDS       T07239                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf01521   EGFR tyrosine kinase inhibitor resistance mpuf01522   Endocrine resistance mpuf04010   MAPK signaling pathway mpuf04012   ErbB signaling pathway mpuf04014   Ras signaling pathway mpuf04015   Rap1 signaling pathway mpuf04062   Chemokine signaling pathway mpuf04068   FoxO signaling pathway mpuf04071   Sphingolipid signaling pathway mpuf04072   Phospholipase D signaling pathway mpuf04137   Mitophagy - animal mpuf04140   Autophagy - animal mpuf04150   mTOR signaling pathway mpuf04151   PI3K-Akt signaling pathway mpuf04210   Apoptosis mpuf04211   Longevity regulating pathway mpuf04213   Longevity regulating pathway - multiple species mpuf04218   Cellular senescence mpuf04360   Axon guidance mpuf04370   VEGF signaling pathway mpuf04371   Apelin signaling pathway mpuf04540   Gap junction mpuf04550   Signaling pathways regulating pluripotency of stem cells mpuf04625   C-type lectin receptor signaling pathway mpuf04650   Natural killer cell mediated cytotoxicity mpuf04660   T cell receptor signaling pathway mpuf04662   B cell receptor signaling pathway mpuf04664   Fc epsilon RI signaling pathway mpuf04714   Thermogenesis mpuf04720   Long-term potentiation mpuf04722   Neurotrophin signaling pathway mpuf04725   Cholinergic synapse mpuf04726   Serotonergic synapse mpuf04730   Long-term depression mpuf04810   Regulation of actin cytoskeleton mpuf04910   Insulin signaling pathway mpuf04912   GnRH signaling pathway mpuf04915   Estrogen signaling pathway mpuf04916   Melanogenesis mpuf04917   Prolactin signaling pathway mpuf04919   Thyroid hormone signaling pathway mpuf04921   Oxytocin signaling pathway mpuf04926   Relaxin signaling pathway mpuf04929   GnRH secretion mpuf04933   AGE-RAGE signaling pathway in diabetic complications mpuf04935   Growth hormone synthesis, secretion and action mpuf05010   Alzheimer disease mpuf05022   Pathways of neurodegeneration - multiple diseases mpuf05034   Alcoholism mpuf05160   Hepatitis C mpuf05161   Hepatitis B mpuf05163   Human cytomegalovirus infection mpuf05165   Human papillomavirus infection mpuf05166   Human T-cell leukemia virus 1 infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05200   Pathways in cancer mpuf05203   Viral carcinogenesis mpuf05205   Proteoglycans in cancer mpuf05206   MicroRNAs in cancer mpuf05207   Chemical carcinogenesis - receptor activation mpuf05208   Chemical carcinogenesis - reactive oxygen species mpuf05210   Colorectal cancer mpuf05211   Renal cell carcinoma mpuf05213   Endometrial cancer mpuf05214   Glioma mpuf05215   Prostate cancer mpuf05216   Thyroid cancer mpuf05218   Melanoma mpuf05219   Bladder cancer mpuf05220   Chronic myeloid leukemia mpuf05221   Acute myeloid leukemia mpuf05223   Non-small cell lung cancer mpuf05224   Breast cancer mpuf05225   Hepatocellular carcinoma mpuf05226   Gastric cancer mpuf05230   Central carbon metabolism in cancer mpuf05231   Choline metabolism in cancer mpuf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpuf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101683038 (NRAS)    04012 ErbB signaling pathway     101683038 (NRAS)    04014 Ras signaling pathway     101683038 (NRAS)    04015 Rap1 signaling pathway     101683038 (NRAS)    04370 VEGF signaling pathway     101683038 (NRAS)    04371 Apelin signaling pathway     101683038 (NRAS)    04068 FoxO signaling pathway     101683038 (NRAS)    04072 Phospholipase D signaling pathway     101683038 (NRAS)    04071 Sphingolipid signaling pathway     101683038 (NRAS)    04151 PI3K-Akt signaling pathway     101683038 (NRAS)    04150 mTOR signaling pathway     101683038 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101683038 (NRAS)    04137 Mitophagy - animal     101683038 (NRAS)   09143 Cell growth and death    04210 Apoptosis     101683038 (NRAS)    04218 Cellular senescence     101683038 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     101683038 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     101683038 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101683038 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101683038 (NRAS)    04650 Natural killer cell mediated cytotoxicity     101683038 (NRAS)    04660 T cell receptor signaling pathway     101683038 (NRAS)    04662 B cell receptor signaling pathway     101683038 (NRAS)    04664 Fc epsilon RI signaling pathway     101683038 (NRAS)    04062 Chemokine signaling pathway     101683038 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101683038 (NRAS)    04929 GnRH secretion     101683038 (NRAS)    04912 GnRH signaling pathway     101683038 (NRAS)    04915 Estrogen signaling pathway     101683038 (NRAS)    04917 Prolactin signaling pathway     101683038 (NRAS)    04921 Oxytocin signaling pathway     101683038 (NRAS)    04926 Relaxin signaling pathway     101683038 (NRAS)    04935 Growth hormone synthesis, secretion and action     101683038 (NRAS)    04919 Thyroid hormone signaling pathway     101683038 (NRAS)    04916 Melanogenesis     101683038 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     101683038 (NRAS)    04726 Serotonergic synapse     101683038 (NRAS)    04720 Long-term potentiation     101683038 (NRAS)    04730 Long-term depression     101683038 (NRAS)    04722 Neurotrophin signaling pathway     101683038 (NRAS)   09158 Development and regeneration    04360 Axon guidance     101683038 (NRAS)   09149 Aging    04211 Longevity regulating pathway     101683038 (NRAS)    04213 Longevity regulating pathway - multiple species     101683038 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     101683038 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101683038 (NRAS)    05206 MicroRNAs in cancer     101683038 (NRAS)    05205 Proteoglycans in cancer     101683038 (NRAS)    05207 Chemical carcinogenesis - receptor activation     101683038 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     101683038 (NRAS)    05203 Viral carcinogenesis     101683038 (NRAS)    05230 Central carbon metabolism in cancer     101683038 (NRAS)    05231 Choline metabolism in cancer     101683038 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101683038 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     101683038 (NRAS)    05225 Hepatocellular carcinoma     101683038 (NRAS)    05226 Gastric cancer     101683038 (NRAS)    05214 Glioma     101683038 (NRAS)    05216 Thyroid cancer     101683038 (NRAS)    05221 Acute myeloid leukemia     101683038 (NRAS)    05220 Chronic myeloid leukemia     101683038 (NRAS)    05218 Melanoma     101683038 (NRAS)    05211 Renal cell carcinoma     101683038 (NRAS)    05219 Bladder cancer     101683038 (NRAS)    05215 Prostate cancer     101683038 (NRAS)    05213 Endometrial cancer     101683038 (NRAS)    05224 Breast cancer     101683038 (NRAS)    05223 Non-small cell lung cancer     101683038 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101683038 (NRAS)    05170 Human immunodeficiency virus 1 infection     101683038 (NRAS)    05161 Hepatitis B     101683038 (NRAS)    05160 Hepatitis C     101683038 (NRAS)    05163 Human cytomegalovirus infection     101683038 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     101683038 (NRAS)    05165 Human papillomavirus infection     101683038 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     101683038 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     101683038 (NRAS)   09165 Substance dependence    05034 Alcoholism     101683038 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101683038 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     101683038 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     101683038 (NRAS)    01522 Endocrine resistance     101683038 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpuf04131]     101683038 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpuf04147]     101683038 (NRAS)    04031 GTP-binding proteins [BR:mpuf04031]     101683038 (NRAS) Membrane trafficking [BR:mpuf04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     101683038 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     101683038 (NRAS) Exosome [BR:mpuf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101683038 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    101683038 (NRAS)   Exosomal proteins of breast cancer cells    101683038 (NRAS)   Exosomal proteins of colorectal cancer cells    101683038 (NRAS) GTP-binding proteins [BR:mpuf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101683038 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  101683038 NCBI-ProteinID:  XP_004769927 Ensembl:  ENSMPUG00000005744 UniProt:  M3Y2Z6 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctggt caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggagcagatt aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaataagtgtgatttg ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaatagcagtgatgatggaactcaaggt tgtatggggttaccttgtgtggtgatgtaa

DBGET integrated database retrieval system